KEGG   Streptococcus gordonii: SGO_0405Help
Entry
SGO_0405          CDS       T00594                                 

Definition
Beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sgo  Streptococcus gordonii
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sgo00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sgo00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
441373..444945
Genome map
AA seq 1190 aa AA seqDB search
MVFHREQRFSIRKFSVGAASVLIGITMAGQVVSAEELPTTQSNVVAPADSTEVKATAEVA
TSSPAQDKSTVEEASGVNSVNNSEATPSTSAPAESNIDIPKQDKTPEKDATGEAEKRNDS
EEKAGLPTDAPKGQESDRVDEKLAMRKMISVDAGRKYFSPEQLKEIVDKAKRYGFTDMHL
LLGNDGLRFQLDDMSLTVGGKTYSSEDVKKAIEKGTNDYYNDPNGNHLTQAEMTDLIDYA
KRQGIGLVPTINSPGHMDAILNAMKELGIEKPNFDYFGKESARTVDLNNQPAVDFTKALI
EKYAAYFAGKTDIFNIGLDEYANDATNAKGWQVLQADKYYPGEGYPEKGYEKFIAYANDL
AKIVKRNGLKPMAFNDGIYYNSDQSFGEFDKDIIVSYWTGGWGGYDVASSKLLSEKGHKI
LNTNDAWYYVLGRNADGQGWYNLDQGLKGIASTPITSVPKSEGADIPIIGGMVAAWADEP
SARFSPSRLYKLMRRFADQNAEYFAANYQDAEKELAAVPSDLASKYTPESIARLKEAEKA
VKELDSHLSRSKQEEIDLAVARLKEAREHLQPTPDYQKVLDAQAEREKLAKSKVISIDAG
RKYFSLDQLKRIIDKASELGYSDLHLLVGNDGMRFMLDDMTVEANGKTYTSDEVKEAILA
GTKAYYDDPNGNALSQKEMDELIAYAKGKGIGLIPALNSPGHMDALLVAMEKLGIQNPQA
YFDTLSKTTLDLENEEAKSLTKALIGKYMDYFAGKTKIFNYGTDEYANDATNAQGWYYLK
YYNLYGKFAEYANSLAATAKERGLQPMAFNDGFYYEDKDDVEFDKDVLISYWSKGWWGYN
LASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLQKALDNTEKTPFNQLASTKYPEVD
LPTVGSMIAIWADRPQAEYKEEEIFQLMTAFADHNKDYFKANYGPIQEEIAKIPTDLSIY
TPESVAALKAAQDEINWELSRMKQEEVDKLAAKLKVARENLKPITYNGSADEEEVRALVE
YKPYLDIQTEEISFETKEVANPNLEKGQRKIVQVGIKGEKTNLVEISARDGSTKLVESFV
SKDAVAEIVEIGTKEADSAKMGGRQVQPAPLVTPSVKGSSPISQVSKKEEGLKPTQTKQP
IAEKLSQPSAQAVAKDNKLPQTGTTSAWPITLLGTALALIGLGGRKKRKG
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atggtctttcatagagaacagcgtttttctattcgcaaattttcagttggagcagcttct
gttctaattggaatcactatggctggacaggttgtttcggcagaagagcttccaactacg
cagtcaaatgttgtcgctccagcagattctactgaagtcaaagctacagcagaagtggcg
acctctagtcccgcacaagataagtctacagttgaggaagcgtccggagtaaattctgta
aacaatagtgaagcaactccatcaacttctgcaccagcagaatctaatatagatattcct
aagcaagacaagacccctgaaaaagatgctactggggaagcagaaaaaagaaatgattct
gaggagaaagcaggcttacctactgatgcaccaaagggtcaagagtcagaccgtgttgat
gaaaagcttgccatgcgcaaaatgatttcagttgatgcaggtcgtaaatattttagtcca
gaacaattgaaagaaattgtagacaaggctaagcgttatggttttacagacatgcattta
ctgttaggaaatgatggactgcgtttccaattggatgatatgtcattgactgtgggcggt
aagacctattctagtgaagatgtaaaaaaagccattgaaaaagggaccaacgattattat
aatgatccaaatggcaatcacttaacacaagctgaaatgacggacttgattgattatgct
aaacgacaaggaatcggtcttgttccaacaatcaatagcccagggcatatggatgcgatc
ctgaatgccatgaaggagctgggaattgaaaaacctaatttcgactactttggcaaggaa
tctgctcgaacagttgatttaaataatcagcctgctgttgatttcacgaaagccttgatt
gagaaatatgctgcatattttgctggtaagacggatattttcaatattggtttagatgaa
tatgctaatgatgcgaccaatgctaaagggtggcaagtcttacaggcggataagtattat
ccaggagaaggttacccagaaaagggctatgaaaaattcatcgcttatgccaatgatcta
gctaaaatcgttaagcgaaatggtctgaagccgatggcctttaatgatggtatttactat
aattctgatcaaagttttggtgaatttgataaagatattattgtatcatactggactggt
ggctggggaggctatgatgttgcttcttccaaacttttgtctgaaaaagggcataagatt
ctaaataccaatgatgcttggtattatgttctaggtcgaaatgcagacggccaaggttgg
tataatctagatcaagggttgaagggaattgcttctacaccgattacaagtgttcctaag
tctgagggggcagatattccaattattggtggtatggtggctgcatgggctgatgagcct
tcagcacgtttttccccatctcgtctttataagttgatgcgtcgctttgctgatcaaaat
gctgagtattttgctgctaattatcaagatgcagaaaaagaattggcagcagtcccaagt
gacttagcttctaaatatacaccagaaagtatcgctcgtcttaaggaggctgaaaaagct
gtgaaagaattagacagccatcttagtcggagcaagcaagaagagattgatcttgcggtt
gctcgcttaaaagaagcccgtgagcatctccagccaacccccgattatcaaaaggtgcta
gatgcccaagctgaaagagaaaaactagctaagagcaaggtgatttctattgacgctggt
cggaaatatttctcattggatcagctgaagagaatcattgacaaggctagtgaattggga
tattcagatttgcatctgctagttggaaatgacgggatgcgcttcatgttggatgacatg
accgttgaagccaacggtaaaacctacacaagtgatgaagtgaaagaagcaatcttggct
ggcaccaaggcttactacgatgatccaaatggaaatgccctcagccaaaaagagatggat
gagctgattgcttatgccaaaggaaaggggataggccttattccggcactcaatagccca
ggccatatggatgcccttttggtcgctatggaaaaactaggtattcaaaatcctcaagct
tattttgatacactatccaaaacaacccttgatttggaaaatgaagaagccaagtccctt
accaaagctttgattggaaagtatatggattactttgcaggcaaaaccaaaattttcaac
tatggaacggatgaatatgccaatgatgcaaccaatgctcagggttggtattatctgaaa
tactacaacctctatggtaagttcgcagaatatgccaactctctagctgctacggcgaaa
gagagaggtttgcagccaatggccttcaacgatggtttctactacgaagacaaagacgat
gttgagtttgataaggatgtcttaatctcctattggtctaaaggctggtggggctataac
ctggcatcaccacagtatttagcaagtaagggctacaaattcctcaataccaatggggat
tggtactacattttgggacaaaaaccggaagatggtggtggtttcttacagaaagcactt
gacaatactgaaaagacaccatttaatcaactagcttctaccaagtacccagaagtagac
cttccaacagtcggtagcatgattgccatctgggctgatagaccgcaagctgaatacaag
gaagaagagattttccaattaatgactgcttttgctgatcataataaagactatttcaag
gctaattatggccctattcaggaagaaattgctaaaatcccaaccgatttaagcatctat
acaccagaatctgttgcagctctaaaagcagctcaagatgagattaattgggaattaagc
cggatgaagcaagaagaggtggataaactagctgctaaactaaaagttgctcgtgaaaat
ctcaagccaattacctataatggcagtgctgatgaggaagaagttcgcgctcttgtggaa
tataaaccatatcttgatattcaaacagaagagatttcctttgagacaaaagaagtagca
aatccaaaccttgaaaaaggtcaacgcaagattgtgcaagtgggaatcaaaggtgaaaaa
acgaatttggttgaaatatctgcccgggacggtagtaccaagcttgtggaaagtttcgtt
tctaaggatgcagtagctgaaattgtggaaattgggacaaaagaagcagattcagcaaaa
atgggtggaaggcaggttcaaccagccccgttggttactccttctgttaagggatcatca
cctattagccaagtaagtaagaaagaagagggtctaaaaccgactcaaactaagcagcca
atagctgaaaaattatctcaaccatctgcccaagcagtggctaaggacaataaacttccg
caaactggaacaacttcagcttggcctataactcttctgggaacagctttagctttgatc
ggtttgggtggacgcaagaaaaggaaaggatga

DBGET integrated database retrieval system