KEGG   Streptococcus gordonii: SGO_0424Help
Entry
SGO_0424          CDS       T00594                                 

Gene name
trpA-1
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00260  Glycine, serine and threonine metabolism
sgo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01130  Biosynthesis of antibiotics
sgo01230  Biosynthesis of amino acids
Module
sgo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGO_0424 (trpA-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGO_0424 (trpA-1)
Enzymes [BR:sgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGO_0424 (trpA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABV09360
UniProt: A8AVD0
Position
469528..470214
Genome map
AA seq 228 aa AA seqDB search
MMPIFYLPISYPDRETFFQLLDLLQKYQVPMVEIGLPATNPFLDGELIQRINHQLLQAGL
STAELTKILLQIREKYTFQVVLMTYKEGVERFSLQELPMDLYAGILCVDAVLSQITFPKQ
VALVSPASKAVDVKTQCVLSHTFIYLMTHSGKTGEKVSLENAPYQEILPLLKHYSKDPVY
VGFGVKNAQDVSCIRDSGADGAIVGTEFLHQYELGGLSQIEQYLQSFQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctattttctatttacccatttcctatccagacagagaaaccttctttcagtta
ctggatttattgcagaaatatcaagtgccaatggtagaaatcggccttcctgcaacaaat
ccttttttagatggagagctgattcaaagaataaatcaccaactgcttcaagcggggctg
tcaacagctgaactgacaaaaatattgttacaaatcagggaaaagtacacttttcaagta
gtgctgatgacctataaagaaggagtggaacgtttttctctacaggagctcccaatggac
ttgtatgcaggaatcttgtgtgtggatgctgttttatcgcagattacctttccaaaacag
gtagctcttgtatctcccgcaagcaaagcagtcgatgtgaaaactcaatgtgttttgtcg
catacatttatctacttaatgactcattctgggaaaactggtgaaaaagtttctttagaa
aatgccccctatcaagaaattttacccctactcaaacattattcaaaagatccagtttat
gttggttttggcgtaaaaaatgctcaagatgtttcttgcatcagggattcaggtgcagat
ggtgccattgttggaacagaatttctccaccaatatgaactgggcggtctttctcagatt
gaacagtatttacaatcatttcagtaa

DBGET integrated database retrieval system