KEGG   Streptococcus gordonii: SGO_0565Help
Entry
SGO_0565          CDS       T00594                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SGO_0565 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_0565 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SGO_0565 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SGO_0565 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGO_0565 (adhA)
   00626 Naphthalene degradation
    SGO_0565 (adhA)
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SGO_0565 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(610155..611177)
Genome map
AA seq 340 aa AA seqDB search
MKAVVVNPESTGVEIIQNKELRPLETGEALVEIEYCGVCHTDLHVAHGDFGKVPGRILGH
EGIGIVKELAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAQLQPGQWIVLYGAGGLGNLAV
QYAKKVFNAHVIAVDINNDKLALAKEVGADIVINGHEVDDVPGLIKEKTNGGAHSAVVTA
VSKVAFNQAVDSVRAGGRVVAVGLPSEMMDLSIVKTVLDGIQVIGSLVGTRKDLEEAFQF
GAEGLVVPVVEKRPVEDAVDVFDEMEAGTIQGRMVLDFTH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttgttgttaatccagaaagcactggtgtggaaattatccaaaacaaagaa
ctccgtccgcttgaaacaggtgaagctcttgtagaaattgaatactgtggtgtctgccac
actgacttgcacgttgcacatggtgacttcggcaaggtcccaggccgtatccttggtcac
gaagggatcggtatcgtcaaagaattggctcctgatgtaaagagcttgaaagtcggtgac
cgcgtcagtgtcgcttggttctttgaaggttgtggcacatgtgaatactgtactacagga
cgtgaaactctttgccgtacagtaaaaaatgctggttattctgttgacggtggtatggct
gaacaatgtatcgtaacagctgactatgctgtcaaagttcctgaaggtcttgatcctgca
caagcttcttctatcacttgtgctggtgtaactacctacaaagccatcaaagaagctcag
ctccaaccaggccaatggatcgtcctttatggtgcaggtggtttgggtaacctagctgtt
caatatgctaagaaagttttcaatgcccatgttatcgcagtcgacatcaacaatgacaaa
cttgccttagcaaaagaagttggtgctgatattgtcatcaatggacatgaagttgatgat
gttcctggtctcatcaaagaaaaaacaaacggcggtgctcattctgctgtcgtaacagcc
gtttctaaagtggccttcaaccaagccgttgattctgtacgtgcaggcggtcgtgtagtt
gccgttggtttgccatctgaaatgatggatctcagcattgttaagactgttctagacggt
atccaagtcatcggttctcttgtaggtactcgtaaggacttggaagaagccttccaattt
ggtgctgaaggcttagttgttccagtcgttgaaaaacgccctgttgaagatgccgtagat
gtctttgatgaaatggaagctggtactatccaaggacgtatggtacttgacttcactcac
taa

DBGET integrated database retrieval system