KEGG   Streptococcus gordonii: SGO_0631Help
Entry
SGO_0631          CDS       T00594                                 

Definition
alpha-glycerophosphate oxidase (EC:1.1.3.21)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
sgo  Streptococcus gordonii
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sgo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(672105..673931)
Genome map
AA seq 608 aa AA seqDB search
MEFSKKTRELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYEEEGATFSLFRL
KVAMDLYDLLAGVNNTPAANKVLSKEEVLEREPELKKEGLVGGGVYLDFRNNDARLVIEN
IKRANQDGALIANHVKAEGFLFDDSGKITGVVARDLLTDEVFEIKARLVINTTGPWSDKV
RNLSNDGEQYSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTT
DTDYTGDLEHPKVTQEDVDYLLGIVNNRFPEANITVDDIESSWAGLRPLIAGNSASDYNG
GNNGTISDESFNSLIATVEAYLSKEKTREDVESAVSKLESSTSEKHLDPSAVSRGSSLDR
DDNGLLTLAGGKITDYRKMAEGAMERVVDILKAEFDRSFKLINSKTYPVSGGELNPANVD
SEIEAFAQLGVSRGLDSKEAFYLANLYGSNAPKVFALAHSIEQAPGLSLADTLSLHYAMR
NELALSPVDFLLRRTNHMLFMRDSLDAIVEPVLDEMGRFYDWTEEEKVTYRNDVQAALAN
NDLEELKK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaagaaaacacgtgaattatcgattaaaaaaatgcaggaacgcacctta
gacctcctgattattggtggtgggattaccggcgctggggtagccttacaagcagcagct
agtggcctggagaccggtctgattgaaatgcaagactttgcagaagggacttctagccgt
tctaccaaattggtccacggtggccttcgttacctcaaacaattcgacgtagaggtggtc
tcagatacagtttctgagcgtgccgtggttcagcaaattgcccctcatattccaaaacca
gatcctatgctgcttcctgtctatgaagaagagggcgctactttcagtctcttccgtctc
aaagtggctatggacctctacgacctcttggctggtgttaacaacactcctgctgccaac
aaggtcttgagcaaggaagaagtgctagaacgggaacctgaactcaagaaggaaggcctg
gtcggcggtggtgtctatcttgacttccgcaacaacgacgctcgtctcgtgattgaaaat
atcaaacgagccaaccaagacggcgctctgattgccaaccatgtcaaagcagaaggcttc
ctctttgacgattctggaaagattacaggcgttgttgcgcgtgacctcttgactgatgaa
gtctttgaaatcaaggcacgcctagtcatcaatacaactggaccttggagcgacaaggtg
cgcaatctgtcaaatgacggtgagcaatattcacaaatgcgtccaaccaagggtgttcac
ttggtagtagactctagcaagatcaaggtttctcaaccagtttactttgacacaggcttg
ggagacggccggatggtctttgtcctgccacgtgaaaataaaacctactttggtacgact
gatactgactacactggcgaccttgagcatccaaaggtaacacaagaagatgtagattac
ctcttgggcattgtcaacaatcgcttcccagaagcaaacattaccgttgatgatattgaa
agcagctgggctggtcttcgtccattaatcgcaggcaatagcgcttctgactacaacggc
ggaaataacggtaccattagcgacgaaagcttcaatagcttgattgcgactgtcgaagct
tatctatcgaaagaaaaaacgcgtgaagatgttgagtctgctgtcagcaagcttgaaagc
agcacatctgagaaacatttggacccatctgcagtttcacgtggttcaagcttggatcgt
gatgacaatggcctgttgacccttgctggtggtaaaatcacagactaccgtaagatggct
gaaggggctatggagcgcgtggtcgacatcctcaaagcagaatttgaccgtagctttaaa
ctcatcaactctaagacctaccctgtttcaggtggagagctcaatccagcaaatgtggat
tccgaaatcgaagcctttgctcaacttggtgtctctcgcggcttagacagcaaagaagcc
ttctatcttgcaaacctttacggttccaatgcacctaaagtatttgccctcgcacacagc
atcgaacaagcaccaggtctcagcctagctgataccttgtcactgcattatgctatgcgt
aacgaattagcactcagcccagtcgacttcctgcttcgccggacaaatcacatgctcttt
atgcgggatagcttagatgctattgtagagcctgttctggatgaaatgggtcgattctac
gactggacagaagaagaaaaagtaacttatcgaaatgatgttcaagctgcccttgcaaat
aacgatttagaagaattaaaaaaatag

DBGET integrated database retrieval system