KEGG   Streptococcus gordonii: SGO_0632Help
Entry
SGO_0632          CDS       T00594                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sgo  Streptococcus gordonii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sgo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(674000..675508)
Genome map
AA seq 502 aa AA seqDB search
MSQEKYIMAIDQGTTSSRAIIFNKKGEKVSSSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAGAFIESGVKPNQIEAIGITNQRETTVVWDKNTGLPIYNAIVWQSRQTAPLAEQLKSQG
YVEKFHEKTGLIIDAYFSATKVRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKELKWDDEILEILNIPKAMLPEVRSNSEIYGKTAPFHFYGGEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGKVY
YALEGSIFIAGSAIQWLRDGLRMVENSPESEKYALNSHNNDEVYVVPAFTGLGAPYWDQN
ARGSVFGLTRGTSKEDFIKATLQSIAYQVRDIIDTMQVDAKTAIQVLKVDGGAAMNNFLM
QFQADILGIDIARAKNLETTALGAAFLAGLSVGYWKDLDELRTLNETGELFEPSMNESRK
EQLYKGWKKAVKATQVFAEIDD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaaaatatatcatggccattgaccaaggaactactagttcccgcgctatc
atctttaacaaaaaaggagaaaaagttagctccagtcaaaaagaatttactcagattttc
cctcaagctggatgggttgagcacaatgccaatgaaatttggaactccgtgcagtccgtt
atcgccggtgccttcatcgaaagtggggtaaaacctaatcaaatcgaagccatcgggatc
accaaccagcgtgaaacaactgtcgtctgggataagaatactggtcttcctatctataat
gctatcgtttggcagtctcgtcagactgctcctctggctgaacaactgaaaagccaaggc
tatgtggaaaaattccatgaaaagactggtttgattattgacgcttacttctctgctacc
aaggttcgctggattttggaccatgtagagggagcgcaagaaagagctgaaaagggcgaa
ttgctctttggtactattgatacctggctggtttggaaattgactgacggcgcagctcat
gtgaccgactactcaaatgcagcccgtaccatgctctataacattaaagaactcaaatgg
gatgatgagattttggaaatccttaacattcctaaggctatgcttcctgaagttcgctct
aactcagaaatttatggtaagactgctccattccatttctacggcggagaagttccaatc
tctggtatggctggtgaccagcaggcagctctctttggtcagttggcttttgagcctggt
atggtcaagaatacttatggaacaggttctttcatcatcatgaacactggtgaagagatg
cagctgtctgaaaacaacctcttgacaaccattggctacggtatcaacggcaaggtttac
tatgctttagaaggttctatcttcattgccggaagtgctattcaatggctgcgcgacggt
cttcggatggttgaaaattcaccagaatctgaaaaatatgctctcaattcccacaacaat
gatgaagtatatgtcgtacctgcctttacaggtctaggcgctccctactgggatcaaaat
gcacgtggatctgtctttggattgacccgcggaaccagcaaggaagactttatcaaggct
actttgcaatccatcgcttaccaagtacgagacatcatcgatactatgcaggtggacgct
aagactgctattcaagtcctcaaagtcgatggcggtgctgctatgaacaatttcctcatg
cagttccaggctgacattttgggaattgatattgcccgtgctaaaaacttagaaacaact
gctctcggtgcagccttcttggcaggactgtcagtaggatattggaaagacttagacgaa
ctccgcactctcaatgaaacaggagaactcttcgagccttctatgaatgaatcccgcaag
gaacaactctacaaaggatggaaaaaagccgttaaggcaacgcaagtctttgcagaaatc
gacgactaa

DBGET integrated database retrieval system