KEGG   Streptococcus gordonii: SGO_0662Help
Entry
SGO_0662          CDS       T00594                                 

Gene name
trpB-1
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgo  Streptococcus gordonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGO_0662 (trpB-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGO_0662 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGO_0662 (trpB-1)
Enzymes [BR:sgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGO_0662 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
706691..707914
Genome map
AA seq 407 aa AA seqDB search
MAYNQPNQEGFYGEFGGRFVPETLMTAVLELDKAYRESKKDPAFQAELDELLKQYVGREN
PLYFAKNLTAYAGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFNMDCTIYMGEEDVKRQALNVFRMELLGAKVESVTDGSRVLKDAVNAALRA
WVAQVDDTHYIMGSALGPHPFPEIVRDYQSVIGREAKRQFAEQNTGALPDALVACVGGGS
NAIGLFYPFVDDSTVAMYGTEAAGRGVDTDEHAATLTKGRPGVLHGALMDVLQDEQGQIL
EAFSISAGLDYPGIGPEHSHFNAIQRATYVPVTDEEALEAFQLLSRIEGIIPALESSHAI
AYAVKLAKELGPDKSMIVCLSGRGDKDVVQVKERLEREAAQKGGAHD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatataatcaacccaatcaagaaggattttacggtgagtttggtgggcgctttgtt
cccgaaacgctgatgacagcagttttggagctggataaagcctaccgtgagagtaaaaaa
gacccagcctttcaggctgagctggacgagttgctgaagcagtatgtagggcgtgagaat
cctctctattttgcaaaaaatctgacagcctatgctggcggtgctaagatttatctgaag
cgggaagacctcaaccataccggggcacataaaatcaataatgccctagggcaggttctg
ctagctaagagaatgggcaagaagaaaatcattgcagagactggtgcgggtcagcacgga
gtagccactgccacagctgcagcccttttcaacatggactgtactatctatatgggcgaa
gaagatgtcaaacgccaagccctcaatgtctttcgaatggaacttctaggagctaaggta
gagtcagtaaccgatggctctcgagtcctcaaggatgcagttaatgctgccttgcgagct
tgggtagctcaggtcgatgatactcactatattatgggctcagccttgggacctcatcct
tttccagagattgtccgcgactatcagagcgtgattgggcgtgaggccaagcggcagttt
gctgagcaaaatacaggtgccttgccagatgctttagtggcatgtgttggcggtggttca
aacgctattggactcttttatccttttgtagatgatagtacagtggctatgtatggaaca
gaagcagctgggcggggcgtagatacagatgaacacgctgcgaccttaaccaagggccgg
ccgggtgttttgcacggtgccttgatggatgtcttgcaggatgagcaaggacagattctg
gaagctttctctatctctgctgggctagactatccgggcatcggtcctgaacattctcat
tttaatgctatccagcgcgccacttatgtcccagtcacagatgaagaagctttggaagcc
tttcagctcctgtctcgtatcgaagggattatccccgctttagagtctagccacgctatt
gcttacgcagttaagctggctaaggagttgggaccagataaatcaatgattgtctgccta
tccggccgtggtgacaaggatgtcgttcaggtaaaggaacgcttggaaagagaagcggct
caaaaaggaggtgcccatgactaa

DBGET integrated database retrieval system