KEGG   Streptococcus gordonii: SGO_0662Help
Entry
SGO_0662          CDS       T00594                                 

Gene name
trpB-1
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00260  Glycine, serine and threonine metabolism
sgo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01130  Biosynthesis of antibiotics
sgo01230  Biosynthesis of amino acids
Module
sgo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGO_0662 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGO_0662 (trpB-1)
Enzymes [BR:sgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGO_0662 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABV09940
UniProt: A8AW05
Position
706691..707914
Genome map
AA seq 407 aa AA seqDB search
MAYNQPNQEGFYGEFGGRFVPETLMTAVLELDKAYRESKKDPAFQAELDELLKQYVGREN
PLYFAKNLTAYAGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFNMDCTIYMGEEDVKRQALNVFRMELLGAKVESVTDGSRVLKDAVNAALRA
WVAQVDDTHYIMGSALGPHPFPEIVRDYQSVIGREAKRQFAEQNTGALPDALVACVGGGS
NAIGLFYPFVDDSTVAMYGTEAAGRGVDTDEHAATLTKGRPGVLHGALMDVLQDEQGQIL
EAFSISAGLDYPGIGPEHSHFNAIQRATYVPVTDEEALEAFQLLSRIEGIIPALESSHAI
AYAVKLAKELGPDKSMIVCLSGRGDKDVVQVKERLEREAAQKGGAHD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatataatcaacccaatcaagaaggattttacggtgagtttggtgggcgctttgtt
cccgaaacgctgatgacagcagttttggagctggataaagcctaccgtgagagtaaaaaa
gacccagcctttcaggctgagctggacgagttgctgaagcagtatgtagggcgtgagaat
cctctctattttgcaaaaaatctgacagcctatgctggcggtgctaagatttatctgaag
cgggaagacctcaaccataccggggcacataaaatcaataatgccctagggcaggttctg
ctagctaagagaatgggcaagaagaaaatcattgcagagactggtgcgggtcagcacgga
gtagccactgccacagctgcagcccttttcaacatggactgtactatctatatgggcgaa
gaagatgtcaaacgccaagccctcaatgtctttcgaatggaacttctaggagctaaggta
gagtcagtaaccgatggctctcgagtcctcaaggatgcagttaatgctgccttgcgagct
tgggtagctcaggtcgatgatactcactatattatgggctcagccttgggacctcatcct
tttccagagattgtccgcgactatcagagcgtgattgggcgtgaggccaagcggcagttt
gctgagcaaaatacaggtgccttgccagatgctttagtggcatgtgttggcggtggttca
aacgctattggactcttttatccttttgtagatgatagtacagtggctatgtatggaaca
gaagcagctgggcggggcgtagatacagatgaacacgctgcgaccttaaccaagggccgg
ccgggtgttttgcacggtgccttgatggatgtcttgcaggatgagcaaggacagattctg
gaagctttctctatctctgctgggctagactatccgggcatcggtcctgaacattctcat
tttaatgctatccagcgcgccacttatgtcccagtcacagatgaagaagctttggaagcc
tttcagctcctgtctcgtatcgaagggattatccccgctttagagtctagccacgctatt
gcttacgcagttaagctggctaaggagttgggaccagataaatcaatgattgtctgccta
tccggccgtggtgacaaggatgtcgttcaggtaaaggaacgcttggaaagagaagcggct
caaaaaggaggtgcccatgactaa

DBGET integrated database retrieval system