KEGG   Streptococcus gordonii: SGO_0663Help
Entry
SGO_0663          CDS       T00594                                 

Gene name
trpA-2
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sgo  Streptococcus gordonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGO_0663 (trpA-2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGO_0663 (trpA-2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGO_0663 (trpA-2)
Enzymes [BR:sgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGO_0663 (trpA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
707907..708686
Genome map
AA seq 259 aa AA seqDB search
MTKTLTQHLETIKREGKGIFLPYIMAGDHEKGLAGLAETIAFLENLGVSAIEIGLPFSDP
VADGPVIEEAGLRSLGHHTSAKSLVASLQKLDTQLPLIIMTYFNPIFQYGLKDFVKDLAT
TPVKGLIIPDLPYEHRNFILPLLEDSDLALIPLVSLTTGLERQQELIKEAEGFIYAVAIN
GVTGKSGSYRNDLDQHLSKLHDIAEIPVLTGFGVSTLEDVDRFNQVSDGVIVGSKIVKAL
HEKDDSIAAFIQEAAAYKK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacactcactcagcatttagaaaccatcaaaagagaaggcaaggggattttc
cttccttatatcatggctggtgatcacgagaaaggtttagcaggattagcagaaactatc
gcatttttggaaaacttgggtgtgtcagccattgaaattggtctgccattttcagaccct
gttgcagatggaccagttattgaagaagctggtctgagaagtctgggtcaccatacttcc
gccaagtctttagtcgcaagcttgcagaagttggacactcagctgcctctcatcatcatg
acctacttcaatcctattttccagtacgggctcaaagattttgtcaaggatttggctacg
acaccagttaaaggattgatcattcctgatctgccctatgagcatagaaatttcatcttg
cctttactggaagattcagatcttgctcttattcctttagtgagcctgacgactggacta
gaacgtcagcaggagctgatcaaggaagctgaaggttttatctatgctgtagccatcaac
ggtgtgacaggtaagagcggaagctaccgcaatgatttggaccagcatttgagcaagctc
catgatattgctgagattccagtgctgacaggttttggcgtttcaactttagaggatgtt
gaccgtttcaatcaagtctcagatggagttattgttggatctaagattgtcaaagctctt
catgaaaaggatgacagtatcgcagcctttatccaagaagcagcagcttataagaaataa

DBGET integrated database retrieval system