KEGG   Streptococcus gordonii: SGO_0704Help
Entry
SGO_0704          CDS       T00594                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGO_0704 (gpmA)
   01230 Biosynthesis of amino acids
    SGO_0704 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_0704 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SGO_0704 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGO_0704 (gpmA)
Enzymes [BR:sgo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SGO_0704 (gpmA)
Exosome [BR:sgo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SGO_0704 (gpmA)
  Exosomal proteins of melanoma cells
   SGO_0704 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
744384..745076
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMPHDDEYSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKHLSDDEIMGVEIPNFPPLVFEFDEKLNVVKEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggaacacaacaagcgattgacgctggt
aaattgatcaaagaagcaggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gcaatcaaaacaacaaacttggctcttgaagctgctgaccaattatgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaacaaagctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctcctgcaatgcctcatgatgacgaatactcagcacatactgaccgtcgttacgcttca
cttgacgattcagtcattccagatgctgaaaacttgaaagtgactttggaacgtgccctt
ccattctgggaagataaaatcgctccagcacttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaacacttgtcagatgatgaa
atcatgggtgtagaaatccctaacttcccaccattggtatttgaattcgacgaaaaattg
aacgtagtaaaagaatactaccttggaaaataa

DBGET integrated database retrieval system