KEGG   Streptococcus gordonii: SGO_0704Help
Entry
SGO_0704          CDS       T00594                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00010  Glycolysis / Gluconeogenesis
sgo00260  Glycine, serine and threonine metabolism
sgo00680  Methane metabolism
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01120  Microbial metabolism in diverse environments
sgo01130  Biosynthesis of antibiotics
sgo01200  Carbon metabolism
sgo01230  Biosynthesis of amino acids
Module
sgo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgo_M00002  Glycolysis, core module involving three-carbon compounds
sgo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_0704 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SGO_0704 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGO_0704 (gpmA)
Enzymes [BR:sgo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SGO_0704 (gpmA)
Membrane trafficking [BR:sgo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SGO_0704 (gpmA)
Exosome [BR:sgo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SGO_0704 (gpmA)
  Exosomal proteins of melanoma cells
   SGO_0704 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Gemini_AC4_5
Motif
Other DBs
NCBI-ProteinID: ABV09871
UniProt: A8AW46
Position
744384..745076
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMPHDDEYSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKHLSDDEIMGVEIPNFPPLVFEFDEKLNVVKEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggaacacaacaagcgattgacgctggt
aaattgatcaaagaagcaggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gcaatcaaaacaacaaacttggctcttgaagctgctgaccaattatgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaacaaagctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctcctgcaatgcctcatgatgacgaatactcagcacatactgaccgtcgttacgcttca
cttgacgattcagtcattccagatgctgaaaacttgaaagtgactttggaacgtgccctt
ccattctgggaagataaaatcgctccagcacttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaacacttgtcagatgatgaa
atcatgggtgtagaaatccctaacttcccaccattggtatttgaattcgacgaaaaattg
aacgtagtaaaagaatactaccttggaaaataa

DBGET integrated database retrieval system