KEGG   Streptococcus gordonii: SGO_0762Help
Entry
SGO_0762          CDS       T00594                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00010  Glycolysis / Gluconeogenesis
sgo00051  Fructose and mannose metabolism
sgo00562  Inositol phosphate metabolism
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01120  Microbial metabolism in diverse environments
sgo01130  Biosynthesis of antibiotics
sgo01200  Carbon metabolism
sgo01230  Biosynthesis of amino acids
Module
sgo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgo_M00002  Glycolysis, core module involving three-carbon compounds
sgo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_0762 (tpiA)
   00051 Fructose and mannose metabolism
    SGO_0762 (tpiA)
   00562 Inositol phosphate metabolism
    SGO_0762 (tpiA)
Enzymes [BR:sgo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SGO_0762 (tpiA)
Exosome [BR:sgo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SGO_0762 (tpiA)
  Exosomal proteins of bladder cancer cells
   SGO_0762 (tpiA)
  Exosomal proteins of melanoma cells
   SGO_0762 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABV10628
UniProt: A8AWA1
Position
802936..803694
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPAVDLTAVLAAAKGSNL
KVAAQNCYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVASTVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagca
aaagcattcgttgaagccgttgcatcaaaacttccttcatcagaccttgttgaagcaggt
atcgcagctcctgcagttgatttgacagctgttcttgctgctgctaaaggttcaaacctt
aaagttgctgctcaaaactgctactttgaaaattcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtacagactacgttgttatcggtcactcagaacgtcgt
gactacttccatgaaactgacgaagatattaacaaaaaagcaaaagcaatctttgcaaac
ggtatgcttccaatcatttgttgcggtgagtcacttgaaacttacgaagctggtaaagct
gctgaatttgtaggtgctcaagtatctgctgcattggctggattgacagctgaacaagtt
gcttcaaccgttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgatttcggt
caagaagttgcggacaaagttcgtgttcaatacggtggttcagttaaacctgagaacgtt
gcttcatacatggcttgcccagacgttgatggtgcccttgttggtggtgcgtcacttgaa
gctgaaagcttcttggcattgcttgactttgtaaaataa

DBGET integrated database retrieval system