KEGG   Streptococcus gordonii: SGO_0762Help
Entry
SGO_0762          CDS       T00594                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGO_0762 (tpiA)
   01230 Biosynthesis of amino acids
    SGO_0762 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_0762 (tpiA)
   00051 Fructose and mannose metabolism
    SGO_0762 (tpiA)
   00562 Inositol phosphate metabolism
    SGO_0762 (tpiA)
Enzymes [BR:sgo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SGO_0762 (tpiA)
Exosome [BR:sgo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SGO_0762 (tpiA)
  Exosomal proteins of bladder cancer cells
   SGO_0762 (tpiA)
  Exosomal proteins of melanoma cells
   SGO_0762 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
802936..803694
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPAVDLTAVLAAAKGSNL
KVAAQNCYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVASTVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagca
aaagcattcgttgaagccgttgcatcaaaacttccttcatcagaccttgttgaagcaggt
atcgcagctcctgcagttgatttgacagctgttcttgctgctgctaaaggttcaaacctt
aaagttgctgctcaaaactgctactttgaaaattcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtacagactacgttgttatcggtcactcagaacgtcgt
gactacttccatgaaactgacgaagatattaacaaaaaagcaaaagcaatctttgcaaac
ggtatgcttccaatcatttgttgcggtgagtcacttgaaacttacgaagctggtaaagct
gctgaatttgtaggtgctcaagtatctgctgcattggctggattgacagctgaacaagtt
gcttcaaccgttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgatttcggt
caagaagttgcggacaaagttcgtgttcaatacggtggttcagttaaacctgagaacgtt
gcttcatacatggcttgcccagacgttgatggtgcccttgttggtggtgcgtcacttgaa
gctgaaagcttcttggcattgcttgactttgtaaaataa

DBGET integrated database retrieval system