KEGG   Streptococcus gordonii: SGO_0763Help
Entry
SGO_0763          CDS       T00594                                 

Gene name
murA-1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sgo  Streptococcus gordonii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sgo00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sgo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
804097..805377
Genome map
AA seq 426 aa AA seqDB search
MDKIIIQGGNNRLVGTVQIEGAKNAVLPLLAATVLASKGKTILTNVPVLSDVFTMNNVVR
GLNTTVDFNQDEHEIVVDASQDITEEAPYKYVSKMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGAEITQTAGYIEAKADKLHGAHIYMDFPSVGATQNIMMAATLA
EGTTVIENAAREPEIVDLAVLLNKMGAKIRGAGTETLTILGVKELTGTKHSVVQDRIEAG
TFMVAAAMTGGDVLIQDAIWEHNRPLLAKLQEMGVSVTEEEEGIRIQSDLSRLKAVSVKT
LPHPGFPTDMQAQFTALMTVVRGESTMIETVFENRFQHLEEMRRMGLHSEIMRDTARIVG
GQKLQGAEVMSTDLRASAALILTGLIASGETKVSKLEHLDRGYYLFHEKLAALGANIKRV
KEDDDE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattattcaaggtggaaataatcgcttagttggaacagtacaaatcgag
ggtgcaaagaatgcagtcttgcctcttttggctgcaaccgtcttggctagtaaaggaaaa
acgattttaacaaatgtacccgtcctttcagacgtcttcaccatgaacaatgttgttcgc
ggtttaaatactactgtagacttcaatcaggatgagcatgagatcgtggtcgatgctagt
caagatattacagaagaagccccctataagtatgtcagcaagatgagggcatctattgtt
gtcctagggcctatcttggcgcgtaatggacatgctaaggtatcaatgcctggtggctgt
acgattggaagtcgtccaattgatttacatctgaaaggccttgaagcaatgggggctgag
attactcagacagccggctatattgaagcaaaagcagataagttgcacggggcacatatt
tatatggatttcccgagtgtaggcgcgactcagaatattatgatggctgcgacactggct
gaagggacaactgttattgaaaatgccgctagagaaccagagattgttgatctagctgtc
ttgctcaataaaatgggagcaaagatccgtggtgcaggaactgagactttaactattctt
ggagtcaaagaattaacgggaaccaaacatagcgttgttcaggatcgaattgaagcggga
acatttatggttgctgctgctatgacaggtggtgatgttctgattcaggatgcaatctgg
gaacacaatcgtcctttgctagctaagcttcaagaaatgggtgtatccgtaactgaagaa
gaagagggaatccggatccaatcagatctatcacgcttaaaagctgttagtgttaaaacc
ctgcctcacccaggttttccaacggatatgcaagctcaatttactgccttgatgacggta
gttcgtggcgaatcaactatgattgagacagtttttgaaaatcgcttccaacatctagaa
gagatgcgtcgtatgggcttgcactctgaaattatgcgggatacagcaagaattgttgga
gggcagaagcttcaaggagcagaggtcatgtctactgatttgagggcaagtgcggcctta
attttgactggccttattgctagtggagaaaccaaggttagcaaattagagcatttagat
cgtggttactatcttttccatgagaaattggctgctctaggagccaacatcaagcgtgtg
aaggaagatgacgatgaatga

DBGET integrated database retrieval system