KEGG   Streptococcus gordonii: SGO_1010Help
Entry
SGO_1010          CDS       T00594                                 

Gene name
rmlC
Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sgo  Streptococcus gordonii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sgo00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sgo00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1059784..1060377
Genome map
AA seq 197 aa AA seqDB search
MTEQFFDKELAAREVPGIPGMLEFDIPVRGDNRGWFKENFQKEKMLPLGFPESFFVEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADDGKVLGSWVDLREGETFGNTYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPALGIQWENLEAAEVSEAD
KNHPLLKDVKPLRKEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaattttttgataaggaattagcagcacgtgaggttcctggaattccagga
atgctggagttcgatatccctgttcgtggagacaaccgaggctggtttaaggagaatttc
caaaaggaaaaaatgctgccgttaggctttcctgaaagcttttttgtagaaggaaaactg
caaaataatgtcagcttttctcgtaaaaatgtcttgcgtggccttcatgctgaaccatgg
gataagtatatttcagtcgctgatgacggtaaggtgctgggttcttgggtagacctgcgt
gagggtgagacctttggaaatacctatcagacagtgatcgatgccagtaagggtattttt
gtgccacgtggtgtagccaacggcttccaagtcctttctgacacggtttcttatagctat
ctagtgaatgactattgggctttggaactcaaaccgaagtatgcctttgtcaactatgca
gacccggctttaggtatccagtgggaaaatctagaagcagcggaagtctcagaagcagac
aagaatcatccattacttaaggatgtcaaaccactaagaaaagaagatttgtaa

DBGET integrated database retrieval system