KEGG   Streptococcus gordonii: SGO_1126Help
Entry
SGO_1126          CDS       T00594                                 

Definition
(GenBank) Tyrosine recombinase xerC
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1171511..1172581
Genome map
AA seq 356 aa AA seqDB search
MRRELLLERIDKLKATMPWYILEYYQSKLAVPYSFTTLYEYLKEYDRFFNWVLESGITNA
SHIAEIPLSVLENMTKKDMEAFILYLRERPLLNANTTQNGVSQTTINRTLSALSSLYKYL
TEEVENEQGEPYFYRNVMKKVATKKKKETLAARAENIKQKLFLGDETEEFLQYIDREYPK
KLSNRALSSFNKNKERDLAIIALLLASGVRLSEAVNLDLKDINLKMMVIEVTRKGGKRDS
VNVAAFAKPYLEEYLSIRSKRYKAEKTDTAFFLTEYRGTPNRIDASSVEKMVAKYSEDFK
VRVTPHKLRHTLATRLYDATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALNKL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagacgtgaactgttattagaaagaattgataaactcaaggccactatgccctggtac
attttggaatattatcagtctaagctggcggtgccatatagttttacaaccttgtatgaa
tatttaaaagaatatgatcgcttttttaattgggtgctagaatctggcataacgaatgct
tcgcatattgctgagatccctctctcggtcttggaaaatatgaccaagaaagacatggag
gcctttattctttatctgcgagagcgaccgcttctcaatgccaatacaactcaaaacggt
gtttcccagacaactattaaccggactctctcagctttgtccagcctatacaaatatttg
actgaggaagttgaaaacgagcagggtgagccctacttctatcgaaatgtgatgaaaaag
gttgctactaagaagaaaaaggaaactctagctgctcgtgctgagaatattaagcagaag
ctttttttaggggatgagacagaagaatttctccagtatattgatagggagtaccctaag
aagctctctaatcgcgccctgtcctccttcaacaagaacaaagaacgagatttagccatc
attgccttgctgttagcctctggtgttcgtctgtctgaagctgtcaatctggacctaaaa
gacatcaatctcaaaatgatggtcattgaagtgacaagaaaaggcggaaaaagggactct
gtcaatgttgctgcttttgctaagccctatttagaagagtacctgagtattcggagcaaa
cgatacaaggccgaaaagactgatacagccttctttttgactgaataccgtggcactcct
aatcgaatcgatgcttccagtgtcgaaaaaatggtagctaagtattctgaggacttcaag
gtgcgagtgacgcctcacaaactccgccacacacttgctacacgtttatacgatgcaacc
aaatctcaagttctcgtcagccatcagctaggacatgctagcactcaggtaacagacctc
tacacccatattgtcaacgacgagcaaaagaatgctttgaataaactatag

DBGET integrated database retrieval system