KEGG   Streptococcus gordonii: SGO_1126Help
Entry
SGO_1126          CDS       T00594                                 

Definition
(GenBank) Tyrosine recombinase xerC
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_4 Phage_int_SAM_1 Phage_integr_3 RRM_3 Phage_int_SAM_5 Peptidase_M36
Motif
Other DBs
NCBI-ProteinID: ABV11074
UniProt: A8AXA5
Position
1171511..1172581
Genome map
AA seq 356 aa AA seqDB search
MRRELLLERIDKLKATMPWYILEYYQSKLAVPYSFTTLYEYLKEYDRFFNWVLESGITNA
SHIAEIPLSVLENMTKKDMEAFILYLRERPLLNANTTQNGVSQTTINRTLSALSSLYKYL
TEEVENEQGEPYFYRNVMKKVATKKKKETLAARAENIKQKLFLGDETEEFLQYIDREYPK
KLSNRALSSFNKNKERDLAIIALLLASGVRLSEAVNLDLKDINLKMMVIEVTRKGGKRDS
VNVAAFAKPYLEEYLSIRSKRYKAEKTDTAFFLTEYRGTPNRIDASSVEKMVAKYSEDFK
VRVTPHKLRHTLATRLYDATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALNKL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagacgtgaactgttattagaaagaattgataaactcaaggccactatgccctggtac
attttggaatattatcagtctaagctggcggtgccatatagttttacaaccttgtatgaa
tatttaaaagaatatgatcgcttttttaattgggtgctagaatctggcataacgaatgct
tcgcatattgctgagatccctctctcggtcttggaaaatatgaccaagaaagacatggag
gcctttattctttatctgcgagagcgaccgcttctcaatgccaatacaactcaaaacggt
gtttcccagacaactattaaccggactctctcagctttgtccagcctatacaaatatttg
actgaggaagttgaaaacgagcagggtgagccctacttctatcgaaatgtgatgaaaaag
gttgctactaagaagaaaaaggaaactctagctgctcgtgctgagaatattaagcagaag
ctttttttaggggatgagacagaagaatttctccagtatattgatagggagtaccctaag
aagctctctaatcgcgccctgtcctccttcaacaagaacaaagaacgagatttagccatc
attgccttgctgttagcctctggtgttcgtctgtctgaagctgtcaatctggacctaaaa
gacatcaatctcaaaatgatggtcattgaagtgacaagaaaaggcggaaaaagggactct
gtcaatgttgctgcttttgctaagccctatttagaagagtacctgagtattcggagcaaa
cgatacaaggccgaaaagactgatacagccttctttttgactgaataccgtggcactcct
aatcgaatcgatgcttccagtgtcgaaaaaatggtagctaagtattctgaggacttcaag
gtgcgagtgacgcctcacaaactccgccacacacttgctacacgtttatacgatgcaacc
aaatctcaagttctcgtcagccatcagctaggacatgctagcactcaggtaacagacctc
tacacccatattgtcaacgacgagcaaaagaatgctttgaataaactatag

DBGET integrated database retrieval system