KEGG   Streptococcus gordonii: SGO_1129Help
Entry
SGO_1129          CDS       T00594                                 

Gene name
lplA
Definition
(GenBank) lipoate protein ligase A
  KO
K03800  lipoate---protein ligase [EC:6.3.1.20]
Organism
sgo  Streptococcus gordonii
Pathway
sgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    SGO_1129 (lplA)
Enzymes [BR:sgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.20  lipoate---protein ligase
     SGO_1129 (lplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lip_prot_lig_C BPL_LplA_LipB
Motif
Other DBs
NCBI-ProteinID: ABV09156
UniProt: A8AXA8
Position
complement(1175450..1176439)
Genome map
AA seq 329 aa AA seqDB search
MKYIVNYSNDTAFNIALEEYAFKHLLDEDEIFLLWINKPSIIVGRHQNTIEEINRDYVRE
HDIEVVRRISGGGAVYHDLNNLNYTIISKENEDRAFDFKSFSTPVINTLAELGVKAEFTG
RNDLEIDGKKFCGNAQAYINGRIMHHGCLLFDVDLSVLANALKVSKDKFESKGVKSVRAR
VTNIVNELPEKITVEEFRDLLLDYMKKEYPEMTEYVFSEKELEEIKQIRDSKFGTWDWNY
GKSPEYNVRRGTKFTSGKVEIFANVVESKIQDIKIYGDFFGIEDVAAVEDVLRGVKYERE
DVLEALETIDISRYFAGISREEIAEAVVG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacattgttaactactcaaatgatacagcttttaatatcgctctagaagaatat
gctttcaagcatcttttggacgaggatgaaattttcctgctctggattaacaaaccttct
atcatcgttgggcgtcaccaaaacactatcgaagaaatcaatcgtgactacgttcgtgag
catgacattgaggttgtccgtcgtatcagtggtggaggagctgtttatcacgatctaaac
aacctcaactacaccattatttcaaaggaaaacgaagatcgtgcctttgacttcaagagc
ttttctacaccggttatcaacaccctggcagagcttggggtaaaggctgaattcactggg
cgtaatgacttggagattgacggcaagaagttctgtggtaatgcgcaagcctatattaac
ggccgtatcatgcaccacggctgtctgctctttgacgttgatttgtctgtcttggcaaat
gcgcttaaagtctctaaagacaaatttgaatcaaaaggggttaaatccgtccgtgcacgc
gtgacaaatattgtcaatgaattgccagaaaagattactgtcgaagaattccgcgacctg
cttctggactatatgaagaaagagtatccagaaatgacagaatatgtcttttccgagaaa
gaactggaagaaatcaagcaaatcagagatagcaagtttggaacttgggactggaactac
ggtaaatcgcctgaatacaatgtgcgtcgaggcaccaagtttaccagcggtaaggtagaa
atctttgccaatgttgttgaatccaagattcaggatattaaaatctatggagacttcttt
ggtattgaagacgtagcagcagtagaagatgtgttacgtggtgttaaatacgaacgagaa
gatgtccttgaagctcttgaaacgattgatattagccgctactttgctggaatcagcaga
gaagaaattgccgaagctgttgtagggtaa

DBGET integrated database retrieval system