KEGG   Streptococcus gordonii: SGO_1130Help
Entry
SGO_1130          CDS       T00594                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_1130
   00020 Citrate cycle (TCA cycle)
    SGO_1130
   00620 Pyruvate metabolism
    SGO_1130
   00630 Glyoxylate and dicarboxylate metabolism
    SGO_1130
   00640 Propanoate metabolism
    SGO_1130
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGO_1130
   00280 Valine, leucine and isoleucine degradation
    SGO_1130
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SGO_1130
Exosome [BR:sgo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SGO_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1176506..1178209)
Genome map
AA seq 567 aa AA seqDB search
MALEVIMPKAGVDMTEGQIVQWNKKVGEFVKEGEVLLEIMTDKVSMELEAEEDGYLIAIL
KGDGETVPVTEVIGYLGEEGENIPTAGAAAPEASPAPAASASNDDDKSDDAYDIVVIGGG
PAGYVSAIKAAQLGGKIALVEKSELGGTCLNRGCIPTKTYLHNAEIIENLGHAANRGIII
ENPSFTVDMDKVLETKNKVVNTLVGGVAGLLRSYGVDVHKGIGTITKDKNVLVNGSDLLE
TKKIILAGGSKVSKINVPGMESSLVMTSDDILEMNEVPENLVIIGGGVVGIELGQAFMTF
GSKVTVIEMMDRIVPAMDAEVSKNLRLILERKGMKILTETKLEEIIEENGKLRIKVEGKE
DIVADKALLSIGRVPDLEGIGEVEFELDRGRIKVNEYMETSVPGIYAPGDINGTKMLAHA
AFRMGEVAAENALKGNHHVAKLNLTPAAIYTLPEVAAVGLTEEQAREKYDVAIGKFNFAA
NGRAIASDAAQGFVKVIADKKYGEVLGVHIIGPAAAELINEASTIIEMEITVEEMLKTIH
GHPTFSEVMYEAFADVLGLAVHSPKKK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggctttagaagtaattatgccaaaagccggcgtagatatgacagaaggacaaatcgtc
caatggaataaaaaagtcggcgaatttgttaaagaaggtgaagtccttctagaaatcatg
accgacaaggttagcatggaattggaagctgaagaagacggctacctgattgctattctc
aaaggtgacggagaaactgttccagtaacggaagttatcggttaccttggtgaagaaggg
gaaaatatcccaacagctggagccgcagcaccagaagctagcccagcgcctgcagctagt
gcttcaaacgatgatgataagagtgacgatgcatatgacatcgtagtcattggtggtgga
cctgctggttatgtctcagccatcaaagccgctcagttaggcggtaagattgccttggtt
gagaagtctgagctcggcggaacctgcttgaatcgtggctgtattcctactaagacttac
ctgcataatgctgaaatcattgaaaaccttggtcacgctgctaaccgcggtatcattatc
gaaaatccaagctttacagttgatatggacaaggtccttgaaactaaaaacaaggttgtt
aatacgcttgttggcggtgttgctggccttcttcgtagctatggcgtagatgttcataaa
ggaattggtaccattactaaagacaagaatgttcttgtaaacggcagcgatctgctagaa
acgaagaagattatccttgctggtggttcaaaagtcagcaagatcaatgtcccaggtatg
gaatcatcacttgttatgaccagcgatgatattctagaaatgaacgaagtgccagaaaat
ctggttattatcggcggtggtgttgtcggtattgagctcggccaagccttcatgacgttt
ggctcaaaagtcactgtcattgaaatgatggaccgtatcgtacctgctatggatgcggaa
gtttctaaaaaccttcgcctcatcttggagcgcaagggcatgaaaattctgactgaaact
aagttggaagaaatcatcgaagaaaacggcaaactccgtatcaaggttgaaggaaaagaa
gatattgtcgcagataaggctctactttctatcggacgcgtgccagacctagaaggcatc
ggtgaggttgaattcgaactggatcgtggccgtatcaaggtcaatgagtacatggaaact
tctgttccaggtatttacgcaccaggtgatatcaatggtactaagatgcttgctcacgct
gccttccgtatgggtgaagttgctgctgaaaatgctctgaaaggaaatcaccacgttgct
aaactcaatctgacacctgcagctatctacaccctgccagaagtagcagcagttggtttg
acagaagagcaagctcgtgagaaatatgatgtagcaattggtaagtttaacttcgctgct
aacggccgtgctattgcttcagacgcagctcaaggcttcgttaaagtcattgctgacaag
aagtatggtgaagtgctcggtgttcatatcattggtcctgctgcagcagaattgatcaac
gaagcatcaaccatcattgaaatggaaatcaccgtagaagaaatgctgaagaccatccac
ggtcacccaaccttttcagaagttatgtacgaagcttttgcagacgtactgggtttggca
gttcactcacctaagaaaaaataa

DBGET integrated database retrieval system