KEGG   Streptococcus gordonii: SGO_1131Help
Entry
SGO_1131          CDS       T00594                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00010  Glycolysis / Gluconeogenesis
sgo00020  Citrate cycle (TCA cycle)
sgo00620  Pyruvate metabolism
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01120  Microbial metabolism in diverse environments
sgo01130  Biosynthesis of antibiotics
sgo01200  Carbon metabolism
Module
sgo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_1131 (sucB)
   00020 Citrate cycle (TCA cycle)
    SGO_1131 (sucB)
   00620 Pyruvate metabolism
    SGO_1131 (sucB)
Enzymes [BR:sgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SGO_1131 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: ABV10614
UniProt: A8AXB0
Position
complement(1178288..1179331)
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLALLPENIENDTIKSPAQIEKVEEVPDTITPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYDVDMSEMLALRKKVLDPIMEATGKKVTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKLSLSELV
VSFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSSTVEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISMLV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgacaagctaagagcgactcctgcggctagaaagttagcggatgatctaggg
atcaacctctatgacgtttctggctcaggtgcaaacggtcgtgtccacaaagaagacgtg
gaaacttataaagacacaaatgtggttcgcatttcgccacttgcaaaacgaattgccctc
gaacataacattgcttggcaggaaatccaaggaacgggtcatcgtggtaagatcatgaag
aaggacgttttggccttgcttcctgaaaatatcgaaaacgatactatcaagtctcctgct
caaattgaaaaagtggaagaagttccagatactatcacaccttatggtgaaattgagcgt
atcccaatgacaccaatgcgtaaggttattgcgcaacgtatggttgaatcttacctaact
gcgccaaccttcacactcaactacgatgtcgatatgtctgaaatgctagctctccgtaag
aaggttcttgatccaatcatggaagcaactggcaagaaagtaactgtcacagaccttctt
tcactcgctgttgtaaagaccttaatgaaacacccttacatcaacgcttcgttaacagaa
gatggcaagaccattatcactcataactatgtcaaccttgctatggcggtcgggatggat
aatggattgatgacgccggttgtttacaatgcagagaaactaagtctgtcagagttggta
gtttcatttaaagatgttattggtcgtaccttggatggtaaattagctccaagtgaattg
caaaattcaaccttcacaatcagtaacttgggaatgtttggtgttcagtcctttgggcca
atcatcaatcaaccaaactcagcaatccttggggttagctcaacagttgagaaacctgtc
gttgttaatggcgaaattgttatccggccaattatgagtctgggcttgaccattgaccac
cgtgttgtcgacggaatggctggagctaagtttatgaaggacttgaaggctttgattgaa
gatccaatttcgatgttggtataa

DBGET integrated database retrieval system