KEGG   Streptococcus gordonii: SGO_1133Help
Entry
SGO_1133          CDS       T00594                                 

Gene name
acoA
Definition
(GenBank) acetoin dehydrogenase
  KO
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_1133 (acoA)
   00020 Citrate cycle (TCA cycle)
    SGO_1133 (acoA)
   00620 Pyruvate metabolism
    SGO_1133 (acoA)
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SGO_1133 (acoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1180680..1181648)
Genome map
AA seq 322 aa AA seqDB search
MATLDKSLLLEMFRKMEEIRRMDLKIAQLVKKGKVPGMTHFSVGEEAANVGAMLALNADD
LITSNHRGHGQAIAKGIDLNGMMAEILGKYTGTCKGKGGSMHIADLDAGNLGANGIVGGG
MGIAVGAALTQQMQKTGKIVVCFFGDGATNEGVFHEAVNMASIWKLPVIFYCINNGYGIS
ADIKKMTNVEHIHHRSAAYGIPGMFIEDGNNVIDVYEGFKKAVDHVRGGNGPVLIESVTY
RWLGHSSSDPGKYRTREEVELWKQKDPIENLRKYLIENNIASAEELEEIQAQVKEAIEAS
VKFAEESPFPPLESAFEDIYAD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttagacaaatctctcctattagagatgttccgtaagatggaagaaatccgt
cgtatggacttgaaaattgcacaactagtaaaaaaaggaaaagttcccggtatgactcat
ttttctgtcggggaagaagcagctaatgttggagccatgctggctttaaatgcagatgac
ctgatcacatccaaccaccgtgggcacggacaagctattgccaaagggatcgacctcaat
ggaatgatggctgaaatccttgggaagtacactggaacttgtaaaggaaaaggtgggtct
atgcacattgcagacctagatgctggtaacctcggtgccaatggtatcgtaggtggtggt
atgggaatcgcagttggggcagcgttgactcagcaaatgcagaagactggtaagattgta
gtctgcttctttggggacggtgctaccaacgaaggtgttttccacgaagcggtaaacatg
gcttctatctggaaactgccagttattttctactgcattaacaatggttatggtatctca
gcggatatcaagaaaatgaccaatgtggaacatattcatcaccgtagtgctgcttacgga
atccctgggatgtttatcgaagatggaaacaatgttatcgatgtctatgaaggatttaaa
aaagctgtagatcatgttcgtggtggcaatggtccagtcttgatcgaaagtgtaacttac
cgctggcttggtcactcatcatctgaccctggtaaatatcgtacgcgtgaagaagtggaa
ttgtggaaacaaaaagacccaatcgaaaaccttcgcaagtacctcattgaaaataatatt
gcaagtgccgaagaattggaagaaatccaagctcaagtcaaggaagcgatagaagcttct
gttaaatttgcggaagaaagtccatttccaccgcttgaatcagcatttgaagatatttac
gcagactaa

DBGET integrated database retrieval system