KEGG   Streptococcus gordonii: SGO_1138Help
Entry
SGO_1138          CDS       T00594                                 

Definition
(GenBank) autolysin, N-acetylmuramidase-like protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosaminidase TarH
Motif
Other DBs
NCBI-ProteinID: ABV10136
UniProt: A8AXB7
Position
complement(1185677..1186366)
Genome map
AA seq 229 aa AA seqDB search
MKKKMSALLAVMTVFMSAIMISALLANNTKSVDANEEQTVQYYNPTEVFISQIAESARQL
GQENDLYASVMIAQAILESNSGRSGLASAPHYNLFGVKGHYGGQSATMLTWEDDGQGNAY
NIDAEFRSYPSYYESLQDYVAILRQGYYANAWKSNTTSYQDATAALTGVYATDSSYNAKL
NYIIEKYNLTQYDTPSYQQAYSGDLVYNIYRQQYTSQEILDEDVAWANR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaaatgagtgcacttttagcagtgatgacagtatttatgtctgctattatg
attagtgctttactagcaaacaatacaaagtcagtcgatgctaacgaagaacaaacagtt
caatactataatccaactgaagtatttatttctcagatagctgaatcagctcgtcaattg
ggtcaggagaatgatttatacgcttctgtaatgatcgcccaagctattcttgaaagtaat
tcaggtcgctcaggcttagcttcagcgcctcactacaatctctttggtgtaaaaggacac
tacggtggccagtctgctacaatgcttacttgggaagatgatggtcaaggtaatgcatat
aatattgatgcagaattccgttcttacccaagttattatgaatcattacaagattatgta
gcaattcttcgccaaggttattatgcgaatgcatggaagagtaacacaactagctatcaa
gatgcaacggcggctttaactggtgtttatgcaacggattcaagttataatgcaaaatta
aattatattattgaaaagtataacttgactcaatatgatactcccagttatcagcaagca
tacagtggcgatcttgtttataatatttatcgtcagcagtatactagtcaagaaatattg
gacgaagacgtcgcttgggcgaaccgttaa

DBGET integrated database retrieval system