KEGG   Streptococcus gordonii: SGO_1142Help
Entry
SGO_1142          CDS       T00594                                 

Definition
(GenBank) hypothetical protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ctr DUF4366 CrgA Glycophorin_A Presenilin CSG2 Orf78
Motif
Other DBs
NCBI-ProteinID: ABV10903
UniProt: A8AXC1
Position
complement(1189206..1189700)
Genome map
AA seq 164 aa AA seqDB search
MIAGFLKMHRPKQSWGLALSIALLAILVLFFQVAEVKADDQVRLNHWRVEKREQSSVEVL
DGSKQIESRNHKKTLREKRQSLALHCHGKGPKNKQNQTSGEETATEEKSKKRDACDVDPN
TDNTETETASVEHKKSDSTVLYISVFGVLALLVVYILFMKAKKK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatagctggttttttaaagatgcataggccaaaacaatcttggggtcttgcattatct
atcgctttgcttgcaattcttgtcttattcttccaagtagcagaagtcaaagctgatgat
caagttcgcttaaatcattggagagtagagaagagagagcaatcttcagttgaagtgctt
gatggttcaaaacagattgaatctcgaaatcacaagaagactttaagagagaaacggcaa
tctcttgctcttcactgccatggaaaggggcctaaaaataagcaaaatcaaacaagtggt
gaagagactgctacagaggaaaagtcaaaaaagagagatgcttgtgatgtagatcctaat
actgataatacggagacggagactgcttctgttgaacataaaaaatcagattctacagta
ttatatatttctgtatttggagttttagctcttttggtagtttacattctattcatgaag
gctaaaaaaaaataa

DBGET integrated database retrieval system