KEGG   Streptococcus gordonii: SGO_1171Help
Entry
SGO_1171          CDS       T00594                                 

Definition
(GenBank) thioredoxin family protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1223188..1223670)
Genome map
AA seq 160 aa AA seqDB search
METKSSSNQPAQNAVGQIAVGQEAPDFTLKSMDGKTVKLSDYKGKKVYLKFWASWCGPCK
KSMPELIELAGKKDRDFEILSVIAPGIQGEKSETDFPKWFEEQGYKDVPVLYDSQATTFQ
AYQIRSIPTEILIDSQGKIGKIQFGAISNEDAEAAFKEMK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaaagcagtagcaatcaacctgctcagaatgctgtcggtcagatagctgtc
ggtcaggaagctcctgattttactttgaagtctatggacggaaaaactgttaagttatct
gattataaaggaaaaaaagtttacttgaaattctgggcttcttggtgtgggccatgtaag
aaaagtatgccagaactaatagaattggctggaaagaaagaccgcgatttcgaaatttta
agtgtcattgccccaggaattcagggtgaaaagtctgaaacagacttccctaaatggttt
gaagaacagggctataaagatgttccagttttatatgatagccaagcaactaccttccaa
gcctatcaaatcagaagtattccaacagaaattctcattgatagtcaaggaaaaattggt
aaaattcaatttggagctatcagcaacgaagatgctgaagcagcctttaaagaaatgaag
taa

DBGET integrated database retrieval system