KEGG   Streptococcus gordonii: SGO_1177Help
Entry
SGO_1177          CDS       T00594                                 

Definition
(GenBank) thioredoxin family protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1228455..1229018)
Genome map
AA seq 187 aa AA seqDB search
MKKITVLTLGLLCAGLLGACSNQKMESEASTNDKSSMTTKKDSDQSSKMAKDFSLQGVDG
KTYKLSDFKGKKVYLKFWASWCSICLSTLGDTNDLAKEQEGKDYVVLSVVSPTFNGEKSA
EDFKKWYKSLDYKDFPVLMDTKGELLKEYGIRSYPSALFVGSDGSLAKTHIGYMSKEDIE
KTLKEIK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattactgtattaactctgggtttgctttgtgcaggcttattgggtgcttgt
tcaaatcagaagatggaatcagaagcctccactaacgataaaagcagtatgacaacaaag
aaggattctgaccaatcttctaagatggctaaagactttagtctgcaaggagtggatgga
aagacctacaaactgtctgattttaaaggaaagaaagtctatttgaaattttgggcttcc
tggtgctctatctgcttatctactcttggcgataccaatgatctggccaaggagcaggaa
gggaaagactatgttgttctatcggttgtgtctccaacgtttaatggtgaaaaatcagcc
gaagattttaaaaaatggtacaagtctttggattacaaagacttccctgttctcatggac
accaagggagaattgctgaaagagtacggaattcgctcttatccatctgctctttttgtt
ggcagtgacggttcacttgccaagacacatattggctacatgagcaaggaagatattgag
aaaacactgaaagaaattaagtaa

DBGET integrated database retrieval system