KEGG   Streptococcus gordonii: SGO_1182Help
Entry
SGO_1182          CDS       T00594                                 

Definition
(GenBank) LPXTG cell wall surface protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSURE YSIRK_signal Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: ABV10414
UniProt: A8AXF9
Position
complement(1232116..1234203)
Genome map
AA seq 695 aa AA seqDB search
MRFNSNQKYTRWSIRRLSVGVASVAVASGFFVLVGHPSSVRADEVNLTPAQVVPNPSSVT
EKSELPENVLKEAVDTALPENQTIPSSKEAVDETNSSEKTSTDSKEEVAKPKEEQDTPKA
NNPTEEQSKPEVAPATVGSQDREAPTPQSVTTPEEVKKGVAENTKETVDVPASYLEKANV
PGPFLAGVNQVIPYEAFGGDGMLTRLLLKSSDKAPWSDNGTANNPALLPLEGLAKGQYFY
EVDLNGNTTGKEGQALLDQLRANGTQAYQAIVKVYSAKDGKPDLTNLVATKDLTVNLNGT
TTISQVKDSVANNIKNSIDVPASYLEKANVPGPFLAGVNQVIPYEAFGGDGMLTRLLLKS
SDKAPWSDNGKANNPALLPLEGLAKGQYFYEVDLNGNTTGKDGQALLDQLRINGTQAYQA
TVKVYGAKDGKPDLTNLVATKNVTVSLNGLVSKESVKDSVTKNIKDHIDVPASYLEKANV
PGPFLAGVNQVIPYEAFGGDGMLTRLLLKSSDKAPWSDNGTANNPALLPLEGLAKGQYFY
EVDLNGNTTGKEGQALLDQLRANGTQAYQATVKVYGAKDGKPDLTNLVATRQVTIQLREK
EMATMPSQPDQMNTKPSETDSIGKVKDMAIEEQHMSDMKVNHPSSSSMADTAKKFDKSTL
PNTGEAQTATATIGFFGLALAGLLGLLGLKEKQKD
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagattcaattcaaatcaaaaatatactcgctggtcaatccgtcgcttaagtgttggt
gtggcttctgttgcagttgccagtggtttttttgtcctagtcggtcatccaagctctgta
cgtgcggatgaagtcaatttaacaccagcacaagttgtaccaaatccttcatcagtaaca
gaaaaaagtgagttaccagaaaatgttcttaaagaagctgtggatacggctcttccagaa
aatcagacgattccaagttcaaaggaagcagttgatgaaactaattcctcagagaagact
agtactgattctaaagaagaagttgcaaaaccgaaagaagaacaggatacaccaaaagcc
aataatccaacagaagaacaaagcaaaccagaggtagctcctgcgacagttggtagccaa
gatcgtgaagcacctactcctcaatcagtaacaactccagaggaagttaaaaaaggagtt
gctgagaatacgaaggaaacagtagatgttccagccagttatcttgaaaaagcgaacgtt
cctggtccattcttggccggagttaaccaagtcattccgtatgaagctttcggtggtgat
ggtatgttgacgcgtcttttgctcaaatcttctgacaaggcaccatggtccgacaatggc
acagcgaataacccagcacttttaccacttgaaggcttggccaaaggtcaatacttctat
gaagtagatttgaacggcaatacgacaggcaaagaaggtcaagcccttctcgatcaactt
cgtgctaatggcactcaagcttaccaagctattgtcaaagtctatagtgccaaagatggt
aagccagatttgacaaatctcgtagcgactaaggatttgacagtaaacctgaatggtacg
accacaatttctcaagtcaaagactctgttgctaacaacatcaaaaatagcattgatgtt
ccagccagctatcttgaaaaagcgaatgttccaggtccattcttagcaggtgtcaaccaa
gtcatcccgtatgaagctttcggtggtgacggtatgttgacgcgtctcttactcaaatct
tctgacaaggctccttggtcagacaatggcaaagcgaacaatccagccctcttgccactt
gaaggcttagctaaaggtcaatacttctacgaagtggatttgaacggcaatactacaggt
aaagacgggcaagcccttcttgaccaacttcgcatcaatggcactcaagcttaccaagcg
actgtcaaagtctatggtgctaaagatggtaaaccagatttgaccaatcttgtagcgaca
aaaaatgtaactgttagtttaaatggccttgtttcaaaagaatcagtcaaagactcagtt
accaaaaatattaaagaccatattgatgttccagctagctacttagaaaaggcaaacgtt
cctggtccattcttggcaggtgttaatcaagttattccgtatgaagctttcggtggagac
ggcatgttgacgcgtcttttgctcaaatcttctgacaaggcaccatggtccgacaatggc
acagcgaataacccagctctcttaccacttgaaggcttggccaaaggtcaatacttctat
gaagtggatttgaatggcaatacgacaggcaaagaaggtcaagcccttctcgaccaactt
cgtgctaatggcactcaagcttaccaagctactgtcaaagtctatggtgccaaagatggc
aaaccagatttgaccaatcttgtcgcaactcgtcaagtaacgattcagcttcgtgaaaaa
gaaatggcgacaatgccatctcaaccagatcagatgaatacgaagccttctgaaacagat
tctattggtaaagttaaggatatggcgatagaggagcaacatatgtcagatatgaaggtt
aatcatccaagttctagctcaatggctgatacagcgaaaaagtttgataaatctacgcta
ccaaatactggtgaagctcaaacagccacagctaccattggcttctttggactagccttg
gcaggtcttcttggacttctaggtttgaaagaaaaacaaaaagattaa

DBGET integrated database retrieval system