KEGG   Streptococcus gordonii: SGO_1211Help
Entry
SGO_1211          CDS       T00594                                 

Definition
(GenBank) hypothetical protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_U4 DUF1673 MaAIMP_sms DUF1129
Motif
Other DBs
NCBI-ProteinID: ABV10335
UniProt: A8AXI8
Position
complement(1260238..1260762)
Genome map
AA seq 174 aa AA seqDB search
MEKENYQFEYYAGSNFYFTNLMFILVMFGFGIVAFISIYMDIDKGIEHGLSHSTLMIIFL
AAIFGGIILYLIKNIFKEKESKVPILAGKKDEFVFRIDDEQISIPWKDIQRISYKKRSEY
SSEGHRSVKHYICPYTQAGPDYEISIDKLDEDQYDIYDVLNKYHPEILLTGFLD
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagagaattatcagtttgaatattatgctggttcgaatttttattttacaaat
ttgatgtttatattggtcatgtttggatttggaattgttgcttttataagtatatacatg
gatattgataagggcatagagcatggtttgtcgcactctaccttaatgattatattctta
gctgcgatctttggcggaatcatactctatctaataaaaaatatatttaaagaaaaagag
agtaaggtaccaattctagctgggaaaaaggatgagttcgtctttcgcattgatgatgaa
caaattagtattccatggaaagatattcaaagaatttcttataagaaacgttccgaatat
agttctgaaggacatagaagtgtaaagcattatatttgtccctatacccaagctggtcct
gattacgaaatttcaattgataaattagatgaagaccagtatgatatctacgatgtctta
aataaataccatccggagattcttttgactggatttcttgattaa

DBGET integrated database retrieval system