KEGG   Streptococcus gordonii: SGO_1221Help
Entry
SGO_1221          CDS       T00594                                 

Gene name
ppnK
Definition
(GenBank) Probable inorganic polyphosphate/ATP-NAD kinase
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00760  Nicotinate and nicotinamide metabolism
sgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SGO_1221 (ppnK)
Enzymes [BR:sgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     SGO_1221 (ppnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_kinase LmjF365940-deam
Motif
Other DBs
NCBI-ProteinID: ABV09301
UniProt: A8AXJ8
Position
complement(1268984..1269808)
Genome map
AA seq 274 aa AA seqDB search
MKNTDKKIAVFSNYKPQSKEVCQLLIKKLRQNRFILTDKNPDIVISVGGDGMLLSVFHKY
EKQLDKVRFVGVHTGHLGFYTDYRDFEIDKLIDNLKLDTGAQVSYPILNVRIFLEDGSVK
TKLALNEATIKRSDRTMVADVMINHVAFERFRGDGISVSTPTGSTAYNKSLGGAVLHPTI
EALQIAEVASLNNRVYRTLGSSIIVPKKDKIEIFPTRNDQHTISVDNRTYTFKHIAKVEF
QIDNHKIHFVASPSHTSFWNRVKDAFIGEVDDEI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatacagataaaaagattgcagtctttagcaattataaacctcaaagtaaagaa
gtctgccaattattgattaagaaactgaggcagaatcgtttcattttaaccgataaaaat
cctgatatagttatttctgtaggtggagatggcatgctcttgtcagtttttcacaaatat
gaaaaacaattagataaagttcgttttgtcggtgttcatactggacacttagggttttat
actgactatcgagatttcgaaattgacaagttaatagataatctaaaattggacacaggt
gctcaggtttcctatccgattttaaatgttagaatttttcttgaggatggttctgtaaaa
actaagctagctttgaatgaagctacgataaagcgatcagatcggactatggtcgctgat
gtcatgattaaccatgtggcttttgaacgcttccgtggggatgggatttcggtttctact
ccgaccggcagtacggcttacaataagtccttaggtggagcagttctccatccgacaatc
gaggctttgcaaattgctgaagtggctagtcttaataatcgtgtatatcgtactttgggc
tcgtctattattgttcccaaaaaagataagattgaaatctttccaactcgaaatgatcag
catacgatttcggtggataatagaacatatactttcaagcatattgccaaggttgaattt
caaatagataatcataaaatacattttgtcgctagcccaagtcatacgagcttttggaac
cgagttaaggatgcctttattggagaagtagacgatgagatttga

DBGET integrated database retrieval system