KEGG   Streptococcus gordonii: SGO_1226Help
Entry
SGO_1226          CDS       T00594                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1273284..1273631
Genome map
AA seq 115 aa AA seqDB search
MAFEKSVALKDCLYSYEVNPNVKKFTLKDNTFAETKVGNFELTRLLEEIPNSGQGFLLKI
IFNKDLSGFKINITDKSGLRLVNIFKSEDQKIIQQKFYFLMDSLVEREIFIKTEQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgaaaagtcagtagcattaaaagattgtttatacagttatgaagtaaatcca
aatgttaaaaaatttacgttaaaggataatacctttgccgaaacaaaagtaggaaacttt
gaactaactcgcctcttagaagaaattccaaatagtggtcaaggatttttgttgaagatt
attttcaataaagacttgtctggttttaaaattaatatcacagataaatctggtcttcgc
ttagttaatatttttaaatccgaagatcaaaagattattcagcagaaattctactttttg
atggatagtttagttgagagagagatttttataaagacagaacaataa

DBGET integrated database retrieval system