KEGG   Streptococcus gordonii: SGO_1227Help
Entry
SGO_1227          CDS       T00594                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4649
Motif
Other DBs
NCBI-ProteinID: ABV09502
UniProt: A8AXK4
Position
1273666..1273899
Genome map
AA seq 77 aa AA seqDB search
MIELKYLDSYKVERIVRYLDFDEFMLAFSGCVTIPDNLKVLSLTYNGKELPYEGKIGNLY
RTMSQFDLSAYESKKEN
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacttaaatacttagattcttataaggtcgaacgaatcgttcgttatcttgat
tttgatgaattcatgctagctttttcaggctgtgtcactattccggataacttaaaggtc
ctctctttgacttataacggtaaggaacttccctacgaaggaaaaataggtaatctctat
cgaactatgtcacagtttgatttatcagcatacgaaagtaaaaaagaaaactaa

DBGET integrated database retrieval system