KEGG   Streptococcus gordonii: SGO_1231Help
Entry
SGO_1231          CDS       T00594                                 

Gene name
gyrA
Definition
(GenBank) DNA gyrase, A subunit
  KO
K02469  DNA gyrase subunit A [EC:5.99.1.3]
Organism
sgo  Streptococcus gordonii
Brite
Enzymes [BR:sgo01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     SGO_1231 (gyrA)
DNA replication proteins [BR:sgo03032]
 Prokaryotic Type
  DNA Topoisomerases
   SGO_1231 (gyrA)
DNA repair and recombination proteins [BR:sgo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      SGO_1231 (gyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C Retrotran_gag_2
Motif
Other DBs
NCBI-ProteinID: ABV10548
UniProt: A8AXK8
Position
complement(1276191..1278644)
Genome map
AA seq 817 aa AA seqDB search
MQDKNLVNVNLTSEMKTSFIDYAMSVIVSRALPDVRDGLKPVHRRILYGMNELGVTPDKP
HKKSARITGDVMGKYHPHGDSSIYEAMVRMAQWWSYRYMLVDGHGNFGSMDGDGAAAQRY
TEARMSKIALEMLRDINKNTVDFIDNYDANEREPIVLPARFPNLLVNGATGIAVGMATNI
PPHNLAESIDAVKLVMDNPEATTRDIMEVLPGPDFPTGALVMGKSGIHRAYETGKGSIVL
RSRTEIEEMKNGRERIVVTEFPYMVNKTKVHEHIVRLVQEKRIDGITAVRDESNREGVRF
VIEVRRDASAHVILNNLFKLTQMQTNFSFNMLAIQNGVPKILSLREILLAYIEHQKEVVT
RRTAFDKDKAEARAHILAGLLIALDHIDEVIRIIRNSETDAEAQAELMAKFELSERQSQA
ILDMRLRRLTGLERDKIQSEYDELIALIADLADILAKPERVLTIIREELDEVKRKFADER
RTELMVGEVLSLEDEDLIEEADVLITLSNKGYIKRLNQDEFTAQKRGGRGVQGTGVKDDD
FVKELVSTSTHDRLLFFTNKGRVYRLKGYEIPEYGRTAKGLPIVNLLKLDEGETIQTIIN
VEQDHSQDSYLFFTTRLGVVKRTSVADFANIRQNGLKALNLKDEDELINVFLTDGAADVI
IGTKFGYSVRFNETAVRNMSRIATGVRGVNLRDGDQVVGAGVVSDNDEVLVITEKGYGKR
TLASEYPTKGRGGKGIKTANITEKNGPLAGLMTVNGQEDLMIITNTGVIIRTSVANISQT
GRSTMGVKVMRLDQNAQIVTFTTVEADDKEELQDEKE
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataagaatttagtaaatgtcaatctaacgagtgaaatgaagacaagtttcatt
gactatgctatgagtgttatcgtttctcgtgcgcttccagatgttcgggatggattaaaa
ccggttcatcgtcgtattctttatggaatgaatgagctgggagttacacctgataaacca
cataaaaaatcagcccgtattacaggtgatgttatgggtaaataccatccgcatggagat
tcttcgatttatgaagctatggttcggatggcgcaatggtggagctatcgctacatgctt
gttgatggccatggaaattttggttccatggacggagatggggctgctgcacagcgttat
acagaagcacgtatgagcaaaattgctcttgagatgcttcgtgatatcaacaagaataca
gttgattttatcgataactatgatgctaatgagcgagaaccaatagtccttcctgctcgt
tttccaaaccttttggtcaatggtgcaactggtattgccgttggaatggcgactaatatt
ccaccacataatttagcggagtctattgatgcggttaagctggtcatggataatcctgaa
gcaacaactcgtgatattatggaagttttgcctgggcctgattttccaacaggagccctg
gttatgggcaaatcaggtattcaccgtgcctatgaaacggggaaaggctcgattgtttta
cgttctcgtactgaaattgaagaaatgaaaaatggtcgcgagcggattgttgtaaccgag
tttccttatatggttaataagactaaggttcatgagcacattgttcgcttagtacaagaa
aaacgtattgatggtataacagctgtccgtgacgagtctaatcgtgagggtgtccgtttt
gtaattgaggtgagacgggatgcgtctgctcatgtcattctaaataatctctttaaattg
acacaaatgcagaccaatttcagcttcaatatgttagctatccaaaatggtgttcctaaa
atactctctcttcgtgagattcttttggcttatattgagcaccaaaaagaagttgtgacc
cgtcgaactgcctttgataaagataaggctgaggcacgtgctcatattttagcaggttta
ctaattgctcttgaccacatcgatgaagttattcgtattattcgtaacagtgagacggat
gcagaagcacaggctgaattaatggctaagtttgaattgtctgagcgtcaaagtcaggct
attctcgatatgcgtttgcgtcgtttgaccggtttggaacgcgataaaattcagtcagaa
tatgatgaattgattgccttaatagctgatttggcagatatcttggctaagcctgagaga
gttcttacaattattagagaagaattggatgaagttaagagaaaatttgctgatgaacgt
cgaacggagcttatggtaggagaggttctctctctagaagatgaagatctaattgaagaa
gcggatgttttgattaccttgtcaaataaaggctacatcaaacgcttaaaccaagatgag
tttacagctcaaaaacgtggaggtcgtggtgttcaagggacaggcgtcaaggatgatgat
ttcgtcaaggaacttgtttcaactagtacacatgatcgtctactcttcttcactaataag
ggacgagtttatcgtctgaaaggatatgagatacctgaatatggccggactgcaaaaggt
ttaccaattgtgaatctcctgaaattggatgaaggagaaacaattcaaactattatcaat
gtggaacaggatcatagccaagactcttatctcttctttacgactcgtctaggggtagtc
aagcgtactagcgtagctgattttgctaatattcgtcagaatggactcaaggctttgaat
ttgaaggatgaagacgagctgattaatgttttcctaactgatggagctgctgatgttatt
atcggaacaaaatttggttattctgttcgcttcaatgagacagctgttcgaaacatgagc
cgtattgcaactggcgtacgtggtgttaacctaagagacggtgaccaggtcgttggtgca
ggtgttgtgtctgacaatgatgaagttcttgttattactgaaaaaggttatggtaagaga
actcttgctagtgaatatccgacaaaaggccgtggtggtaaagggattaaaacagctaat
atcacagaaaaaaatggtcctttagctggtttgatgacagtcaatggtcaagaagatctg
atgatcataaccaatactggtgtaatcatacggaccagtgttgcaaatatttcacaaact
ggtcgctctacaatgggtgttaaggttatgcgtcttgatcagaatgctcagattgttact
tttacaactgtagaagcagatgataaagaagagttgcaagacgagaaggagtaa

DBGET integrated database retrieval system