KEGG   Streptococcus gordonii: SGO_1238Help
Entry
SGO_1238          CDS       T00594                                 

Gene name
ilvE
Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00270  Cysteine and methionine metabolism
sgo00280  Valine, leucine and isoleucine degradation
sgo00290  Valine, leucine and isoleucine biosynthesis
sgo00770  Pantothenate and CoA biosynthesis
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01130  Biosynthesis of antibiotics
sgo01210  2-Oxocarboxylic acid metabolism
sgo01230  Biosynthesis of amino acids
Module
sgo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sgo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SGO_1238 (ilvE)
   00280 Valine, leucine and isoleucine degradation
    SGO_1238 (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    SGO_1238 (ilvE)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SGO_1238 (ilvE)
Enzymes [BR:sgo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SGO_1238 (ilvE)
Amino acid related enzymes [BR:sgo01007]
 Aminotransferase (transaminase)
  Class IV
   SGO_1238 (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: ABV09737
UniProt: A8AXL2
Position
complement(1282321..1283343)
Genome map
AA seq 340 aa AA seqDB search
MTVNLDWENLGFSYMKLPYRFLAYYRNGQWEEGKLTEDATLHISESSPSLHYGQQAFEGL
KAYRTKDGSVQLFRPDENAKRLQRTCDRLLMPQVSTEMFVEACKAVVRANEEYVPPYGTG
GTLYLRPLLLGIGDIIGVKPAEEYIFTIFAMPVGNYFKGGLVPTNFLIQDEYDRAAPHGT
GAAKVGGNYAASLLPGKMAKSHNFSDVIYLDPSTHTKIEEVGSANFFGITANNEFVTPLS
PSILPSITKYSLLYLAEHRLGLTPIEGDVPINDLDRFVEAGACGTAAVISPIGGIQHGDD
FHVFYSETEVGPVTRKLYDELTGIQFGDVEAPEGWIYKVD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaatctcgactgggaaaatctaggattctcatatatgaaattgccttatcgc
tttttagcttattaccgcaatggtcagtgggaggaaggcaaactgacagaagatgcgacc
ctgcatatttctgagtcttcaccaagccttcactatggtcagcaggcttttgaaggactt
aaggcttatcgaaccaaggatggcagtgtccagctcttccgtccggatgagaatgctaag
cgcctgcaacgcacttgcgatcgtctcttgatgccacaagtttcaactgaaatgtttgtg
gaagcttgtaaggctgtcgtccgtgcgaatgaggaatatgtaccgccatatggaacagga
gggactctctaccttcgtccacttttgcttggtatcggagatatcatcggggtaaaacca
gcggaagagtatatttttacgatttttgctatgccagttggaaactacttcaagggtggt
ttggttccaaccaacttcttgatccaagatgaatatgaccgagcggctccacatggtaca
ggtgctgctaaggtaggtggtaactatgcagccagtctcctaccaggtaagatggctaag
tctcataacttttcagatgtcatctacttagatccatcaactcatactaagattgaagaa
gtaggatcagcgaacttctttggaattacagcaaataatgaatttgtaacaccgctgagt
ccatccattctaccgtccattaccaaatattccttgctttacttggcagagcaccgcttg
ggcttgactccgattgaaggcgatgttccgattaatgatttggatcgctttgttgaagcc
ggagcttgtggtacagcggcagttatctcaccaatcggaggtatccaacatggtgatgat
ttccatgtattctatagcgagacagaagtcggtccagttacccgcaagttgtatgatgaa
ttaactggtatccaatttggtgatgttgaagcgccagaaggttggatctacaaagttgat
tga

DBGET integrated database retrieval system