KEGG   Streptococcus gordonii: SGO_1244Help
Entry
SGO_1244          CDS       T00594                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1288725..1290125)
Genome map
AA seq 466 aa AA seqDB search
MIKEIDGIEYIEYSKEVEFNIKKGVNLRDKKIREAGDLKFDSRNLILEKRVESKSYLEQV
KEKFDLFNIQLPTKNQMENEIRELDLVVDQFTASMLKNFYDSVLVDDEAILYEYLKKIGF
QPYMLDYIVNGLFIEKTLGNFKKINVKHIVKIDDIDKVFREKILRWILGIENSYKSLLSR
LATQREGGDEIAARVVRHWKNSTDDVKERQYKRAQNRYKYLSYSDKFDYINSDIIPLDDL
MDQMDLSTLESLLDKFDAFSKESISTGGRLLTPFVRDIVLHKTVLSDLRIIRNAAAHGRF
VIPTIVNPDYNPNWDLEFDNPLERTKIKDWFIFGYLKQVLMSQEFDELMSVKVAQTIFGN
PYRKAWFELNFIYHRFISLFDEKMYNDFKNESNYFLDYDSDYDRNEQEKNVNPILKDIGD
LTMFESDALHQDFPPAYKTIANEASLAEQTATLHFSETGINLQKYF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagaaatagatggtattgagtacattgaatatagcaaagaggtagagtttaat
ataaaaaagggagtgaatcttagagataagaaaattagagaggctggtgacttaaagttt
gattctcgaaatttaattctggaaaagcgtgtggaatcaaagtcctatttggaacaagta
aaagaaaaatttgatttgtttaatattcaactaccaaccaaaaatcaaatggaaaacgaa
atcagagaacttgatttggtggttgatcagtttactgcttctatgttaaaaaatttttat
gattctgttttggtagatgatgaagctattttatatgaatatttgaaaaaaataggattc
caaccctatatgttagattatattgttaatggtctttttattgaaaaaactttgggtaat
tttaaaaaaattaatgtgaaacacattgttaaaattgacgatattgataaagtgtttagg
gaaaagatattaagatggatattagggattgaaaattcatacaaaagtttattaagtaga
ttagctactcagagagaaggtggagatgaaattgccgctagagttgttaggcattggaaa
aattccaccgacgatgttaaggaaagacaatataaaagagcccaaaacagatataagtat
ctaagttactcagataaatttgattatattaattccgatataatcccattagatgattta
atggaccaaatggatttgagtactttagaatctttacttgataagtttgatgctttttca
aaagaaagtatttctacagggggacgtttattaactccttttgtcagagatattgtttta
cataaaacagtactttcagatttaagaattataagaaatgcagcggcacatggaaggttt
gtgattccaactatagtaaatcctgattataatcctaactgggatttggagtttgataac
cctcttgaaagaactaaaattaaagattggttcatatttggttatttaaaacaggtactg
atgtcccaagaatttgacgagcttatgtcagttaaggttgcacaaaccatttttggtaat
ccctacagaaaagcttggtttgaacttaattttatttatcatcgattcattagtcttttt
gatgagaaaatgtataatgattttaaaaacgaatcgaattatttcttagattatgacagt
gattatgatagaaatgaacaagaaaaaaatgtcaatcccattttaaaagatattggagac
ttaacaatgtttgagtcagatgcacttcatcaggattttcctccagcgtataaaacaata
gcaaatgaagcatcacttgcagagcaaacggcaaccctccatttttctgaaacaggaata
aatctacagaagtatttttga

DBGET integrated database retrieval system