KEGG   Streptococcus gordonii: SGO_1253Help
Entry
SGO_1253          CDS       T00594                                 

Gene name
pyrE
Definition
(GenBank) orotate phosphoribosyltransferase
  KO
K00762  
orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
sgo  Streptococcus gordonii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGO_1253 (pyrE)
Enzymes [BR:sgo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     SGO_1253 (pyrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1300279..1300908)
Genome map
AA seq 209 aa AA seqDB search
MTLAKEIARDLLKIKAVYLKPEEPFTWASGIQSPIYTDNRVTLAYPETRTLIEDGFVEKI
RAEFPDVEVIAGTATAGIPHGAIIADKMNLPFAYIRSKPKDHGAGNQIEGRVAPGQKMVV
IEDLISTGGSVLDAIAAAKREGADVIGAAAIFTYELPKADKNFNDAGVKLVTLSNYTELI
HLAEQEGYINAEGLALLKRFKEDQENWHL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgactttagcaaaagagattgcgcgtgatttattgaaaattaaggctgtgtatttgaag
ccagaagagccttttacatgggcatcaggtatccagtcacctatttacacagacaaccgt
gtgaccttggcctatccagagactcggaccttgattgaagatggttttgtcgaaaaaatt
cgggcagaatttccagatgtagaagtcattgctggaactgcgacagcaggtatccctcac
ggagccattatcgctgataagatgaacctgccatttgcctatatccgtagcaaaccaaaa
gatcacggagcgggcaatcaaatcgaaggtcgcgtagcgcccgggcagaagatggttgtc
attgaggacttaatctcgactggcggttcggtcttggatgctatcgctgccgccaaacgt
gaaggtgcggatgtgattggcgcagcggccatctttacctatgagctaccaaaggcagat
aagaactttaatgatgcgggtgtgaaattagtgactttatcaaactatacagagttgatt
cacttagctgagcaagaaggctatatcaatgctgaaggattagccttgttgaaacgcttt
aaggaagatcaagaaaattggcatctgtaa

DBGET integrated database retrieval system