KEGG   Streptococcus gordonii: SGO_1257Help
Entry
SGO_1257          CDS       T00594                                 

Definition
(GenBank) probable transcriptional regulator (LysR family)
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1303875..1304783
Genome map
AA seq 302 aa AA seqDB search
MRIQQLHYIIKIVETGSMNEAAKQLFITQPSLSNAVRDLENEMGIDIFIRNPKGITLTKD
GMEFLSYARQVVEQTQLLEERYKNPVAHRELFSVSAQHYAFVVNAFVSLLKKSDMEKYEL
FLRETRTWEIIDDVKNFRSEIGVLFLNGYNRDVLSKMLDDNHLIATHLFTAQPHIFVSKS
NPLAKKKLVQLSDLENFPYLSYDQGTHNSFYFSEEILSQEHHKKSIVVSDRATLFNLLIG
LDGYTIATGILNSNLNGDNIVSIPLDIDDPIELVYIKHEKASLSKMGERFIEYLIEEVKF
DK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagaattcaacaactacactatattatcaaaatcgtcgaaactggcagcatgaatgaa
gctgccaagcaactatttattacccaacctagtctctctaatgcagtacgagaccttgaa
aacgagatggggattgatattttcatacgaaatcctaagggaatcacattaaccaaagac
ggcatggaatttctatcttatgctcgtcaggtggttgagcaaacacaacttctagaggaa
cggtacaagaaccctgtcgcccatcgcgaactcttcagcgtatctgcccaacactatgct
tttgtagtcaatgcttttgtctcccttcttaagaaaagtgatatggaaaaatatgagcta
tttcttcgggaaactcgtacttgggaaatcattgatgatgtcaaaaacttccgaagcgaa
atcggtgttctcttcttaaacggatataaccgtgatgttttatccaaaatgctagatgat
aatcatctgattgcaactcatctcttcacagctcagccccatatctttgtcagcaagtcc
aatcctcttgctaagaaaaaattggtccaactgtcagatttagaaaatttcccttacctc
agctacgaccaagggacacataattccttctacttttctgaggaaatcctctcccaagaa
caccataaaaagtctatcgtagtcagtgaccgagctactctttttaacctcttgattggt
ctggacggatacacgattgctactggtatcctcaacagcaacctcaatggtgacaacatt
gtctctattccgcttgatattgatgacccaattgagctagtctacatcaaacatgaaaaa
gccagcctatctaagatgggagaacgattcattgagtatctgattgaggaagtgaagttt
gataaataa

DBGET integrated database retrieval system