KEGG   Streptococcus gordonii: SGO_1267Help
Entry
SGO_1267          CDS       T00594                                 

Definition
(GenBank) thioredoxin family protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin Thioredoxin Thioredoxin_8 Thioredoxin_2 TraF DUF953 Thioredoxin_7 Thioredoxin_9 Thioredoxin_4 GSHPx DUF2847
Motif
Other DBs
NCBI-ProteinID: ABV09652
UniProt: A8AXP1
Position
complement(1313789..1314292)
Genome map
AA seq 167 aa AA seqDB search
MLYFSGTKKNDKASTQTSGSAAVEHVLTGQQLPEFEMEDQLGALKKSSEFYDKPMLVVEW
ASWCPYCQRQLPEIQKVYEKYKNKINFVMLDMLDFHKETKEQADQYVSEKGYTFPYYYDA
SEKAADILHVQSIPGIYLVDKNQKVKKVILNFHDEAALEKELEEILK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgctttatttttctggaactaaaaagaacgataaagcttctacacagacaagtggtagt
gctgctgtagaacacgtattgacagggcagcaattaccagagtttgaaatggaagatcag
ctaggggccttaaagaagagttcagagttttatgataagcctatgctggtagtagagtgg
gctagctggtgtccttattgccagcgacagttaccggagattcaaaaagtttacgaaaag
tataaaaacaaaataaattttgtcatgttggatatgcttgattttcataaggaaacaaag
gaacaagcggatcagtatgtcagtgagaaaggctataccttcccgtattactatgatgca
agtgagaaagcagcggatatcctccatgttcaatcaattcctgggatttacctagtcgat
aagaatcaaaaagtaaaaaaagtgatattaaactttcatgacgaagcagcgctcgaaaaa
gagctagaagagattttaaaataa

DBGET integrated database retrieval system