KEGG   Streptococcus gordonii: SGO_1340Help
Entry
SGO_1340          CDS       T00594                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGO_1340
   01230 Biosynthesis of amino acids
    SGO_1340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_1340
   00030 Pentose phosphate pathway
    SGO_1340
   00051 Fructose and mannose metabolism
    SGO_1340
   00052 Galactose metabolism
    SGO_1340
  Energy metabolism
   00680 Methane metabolism
    SGO_1340
Enzymes [BR:sgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SGO_1340
Protein phosphatases and associated proteins [BR:sgo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SGO_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1384370..1385380)
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVFGIYDGYAGMVAGSIQPLTAASVGDI
ISRGGTFLHSARYPEFAQKEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRNAGDIALWA
GIATGADEIIVPEEGFKFEEIVASIKHGYEEGKKHNIIVLAEGVMSADEFGEKLKAAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVELLKKGIGGVAVGIRNEKMVENPILGT
AEEGALFSLAEDGKIIVNNPHKADLALSSLNRSISI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggagatgcccctggaatgaatgctgccatc
cgtgcagtagttcgtaaagcgatttctgaaggaatggaagtatttggtatctatgatgga
tatgctggcatggttgcgggttcaattcaaccgttaactgctgcatcagtaggtgatatc
atttctcgaggtggtactttccttcattctgcacgttaccctgaatttgcgcaaaaagaa
ggccaacttaagggaattgagcaattgaaaaaacatggaattgaaggtgtcgtggttatt
ggtggtgacggttcttaccacggtgctatgcgtttgacagagcatggcttcccggctgtt
ggtgtaccaggtacaatcgataatgacatcgttggtactgattttacaattggttttgat
acagcagtaacaacagcaatggatgcgattgacaagattcgtgatacttcatctagtcac
cgtcgtacttttgttgttgaagtaatgggacgtaatgctggagatatcgcgctatgggca
ggtattgctactggtgcagatgagattattgttcctgaagaaggtttcaaatttgaagag
attgtagctagcatcaagcatggatatgaggaaggcaaaaagcataatatcattgttctt
gcagaaggtgttatgtcagcggatgaatttggcgaaaagttaaaagctgctggtgataca
agcgaccttcgtgtaactgagcttggccacatccaacgtggtggttctccaactgctcgt
gaccgtgttcttgcttctcgtatgggagcacatgctgttgaattgcttaaaaaagggatc
ggtggtgtagctgttggtatccgcaatgagaaaatggttgaaaatccaattctcggaaca
gcagaagagggtgcactctttagcttggcggaagatggtaagattatcgtcaacaatccg
cacaaggcagatcttgctttgtctagtctaaatcgtagtatttctatttaa

DBGET integrated database retrieval system