KEGG   Streptococcus gordonii: SGO_1486Help
Entry
SGO_1486          CDS       T00594                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sgo  Streptococcus gordonii
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SGO_1486
  Lipid metabolism
   00600 Sphingolipid metabolism
    SGO_1486
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SGO_1486
Enzymes [BR:sgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SGO_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1535957..1543009)
Genome map
AA seq 2350 aa AA seqDB search
MEKGYWNRKRVYSIRKFTVGACSVLIGTCAVLFGASLSAGNPVYAEEVAVNASAESVKEE
GMIEEENSDKVVATSELSEAADASPALSTQETFPEKTEENSPSPKIEKEFSESVKNEAKE
ISESSAQEGSEKDKMKSATEEEVSQMIEDRKVNFNQNWHFKLNANAKEAVKEEADVTSWK
KLDLPHDWSIHFDFDQDSPAQNEGGQLNGGDAWYRKPLKLDEKDLDKNVRLTFDGVYMDS
QVYVNGQLVGHYPNGYNQFSYDITNFLHKDGRENIIAVHVINKQPSSRWYSGSGIYRDVS
LLIRDKVHVQKNGTTILTPQLESQKDGKVDTLVSSKIVNTDDKDHEITAEYQIVRRGGEA
VTEVIRTASQKLKAHETSTIQTSLQVERPELWTVLNDKPALYELVTRIYRDGQLVDAKKD
LFGYRYYNWTPNEGFSLNGQRIKFHGVSLHHDHGALGAEENYKAEYRRLKQMKEMGVNSI
RTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPYDYGRFFEKDATHPEAQKGEKWSD
YDLRTMVERGKNNPAIVMWSIGNEIGEANGDAHSLATVKRLVKVIKSVDKTRYVTMGADK
FRFGDGSGGHEKIADELDAVGFNYSEDNYKALRAKHPNWLIYGSETSSATRTRGSYFHPE
QEWVGSNQSWRNYEQSDYGNDRVGWGKTATASWTFDRDNAGYAGQFIWTGTDYIGEPTPW
HNQNSTPVKSSYFGIVDTAGIPKNDYYLYQSQWVSVKKKPMVHLLPHWNWQDQELADNVA
DAENKIPVRAYSNAASVELFLNNQSLGLKKFNKKETSDGRSYQEGANPQELYLEWKVAYQ
PGTLEAVARDDQGKEIARDKIVTAGQPAGVRLVKEEHAIAADGKDLTYIYYEIVDRDGNV
VPTANNLVRFQLHGQGQLVGVDNGEQASRERYKEQADGSWIRKAFNGKGVAIVKSTDQAG
KFTLTAHSDLLKSDQVTIFTGKNDQKDKTVLGTEVPKVRTVLGQAPSLPATVPFVYSDGS
RTEQPVTWSQADVSHSGIVTVKGESEGRQVEARVEVLAVERELPVIKRVAPGTDLSAVDK
SVALALTDGSLEHYDVDKWEIAPEDKEKLSVPGSRIQMTGQLAGTKVSATLLVTDREAEA
PVNPVVTLDGDSVTGLTSQKPVHYHSLAYGSQLPLVAATAENADVTVVQASVANGLRASI
YVQPKDGGTLQTYAVQFLEEAPKIERLSLQVEQANHLKEDQTVQLTVLAHYQDGTQAVLQ
ADKVAFSTTGEGELAVRKGMLELHKPGIVTLKAEYEGAEGQVNLTIQANTENKTVQSVRP
VSVVTDLHQEPNLPTTVTVEYDKGFPKVHKVTWQAMAKEELDRYHTFEVVGKVEGIDQKA
IAKVSVEGIIAVEEVSVTTPIAEAPHLPESVRTYHSNGQVSSAKVTWEPIAPSQYQKEGV
FTVSGQVEGSSLPTKLHVRVSAQTENGANISDQWTGSELPLAFASDSNPSDSVSNVNDKV
ISYTDQPANRWTNWNRREEDSVGVLFGDSGILTKRSVDNLNVAFHEDHGVGAPKSYVIEY
YVGQATPTAPKNPSFVESEEHVFNDDSNWKPVTNLKAPDQLKAGEMNHFNFDKVDTYAVR
IRMVRADDKLGTSITEVQIFSKQVAPAKQAQTRIQVAGQDLPNFNPNLTDYYLEAKDGKA
DEVTASVSNNGLATVVPSVREGDPVRVIVKAENGDILGEYRIHFTKDKDLLARKPIATVK
QARLLQLGQNLELPSKVPVYFTGEKDYEVKDLAVEWEPVPAENLSKAGQFTVHGRLVGSN
LAVELRVRVTDKLGESVSDNPYYDENSNQAFASETNDADPDSHDRVDYINDGDLDEGRRW
TNWSATPSANPDVSAGVIFKENGKIVERTVNQAKLHFFADSGTDAPSKLVLERYVGPDFD
VPIYYSNYRAYESNHLFNNPDNWESVPYNMKQDIQAGTELTATFNAVKSKAMRWRMDRKA
NKNGVALIEMTFLAPSELPKESTKSKILLNGKELPDFSAERLEYQVSYSGQRPKVTVEEN
DQVASTVVDSGDNRLPVLVRLLSESGKQVKEYRIQLTEEKTTAGKVEATVQEELPRLEVE
EKELSYQTIEKEDANLYLGESRVEEEGQNGKERIFTEVSPDGQRVEKLREVVQDPINRVL
LVGIKKGTALPEDDIKDLVLYRPELLIEEEEVDFQVQERKNDMLPVGQTRIIQEGRKGIR
VNLVELENGKRTLKESYNKLETQDQILEVGTALSEEKPKSQDTYKAHSQTSEQDKYQSLE
EKVQGTKAMKEEHTEAKSEAVQLQAEKVKSTENSHLPNTGSQSDQAAITTGLALLGLGAS
LVAGKRRKED
NT seq 7053 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggatattggaatcgtaaaagagtctatagcatccggaaatttactgttggt
gcatgctcagtgcttattggaacttgtgcagttttgtttggagctagtctttctgcagga
aatcctgtttatgcggaagaagtggccgttaacgctagtgctgaaagcgtcaaagaagaa
ggaatgattgaggaagagaactctgataaagtagttgccactagtgaattgtctgaggct
gcagatgctagtccagctctttcaacacaggaaactttcccagagaaaacagaagagaat
tcacctagtcctaagatagaaaaagagttttctgaatcagtaaaaaatgaagcgaaagaa
ataagcgagtcctctgcccaagaaggatcagaaaaggataagatgaaatctgctactgag
gaggaagtgagtcaaatgattgaggatagaaaggtcaattttaatcagaactggcacttt
aaattaaacgctaatgctaaggaagcagtaaaagaagaagctgatgtgacttcatggaaa
aaattagacttacctcatgactggagtatccactttgactttgatcaagactctcctgca
caaaatgaaggtgggcagcttaatggtggagacgcttggtatcgcaagccccttaaatta
gatgaaaaggatttagataaaaatgttcgtctgacctttgatggggtctatatggattcg
caagtctatgtgaatggccagctggtcggtcattatccaaatggttacaatcaattttca
tacgatattacaaactttcttcataaagatgggcgggagaatatcattgctgttcatgtg
attaacaagcagccaagcagtcgttggtattcaggaagtggaatctaccgtgacgtttct
cttcttatcagagataaggttcatgttcaaaagaacggaacaactatcttgactcctcag
ttggaaagtcaaaaagatggaaaggtagacactcttgtcagcagtaagattgttaataca
gatgataaagatcatgaaatcacagctgaataccaaattgtgagacgaggcggagaagct
gtaacagaagtgattcgtactgccagtcaaaaactgaaagctcatgagactagtacaatt
cagacaagtctacaagttgaaagaccagaactgtggactgtgctgaatgataagcctgcc
ttgtatgagctagtaacacggatttatcgtgatggtcagcttgttgacgctaagaaagac
ttgtttggttatcgctattataactggactcctaatgaaggtttctctttgaatggtcag
agaatcaaatttcacggggtttccttacaccatgatcacggagccctaggagcagaagaa
aactataaggctgagtatcgtcgtctcaagcaaatgaaggaaatgggggttaattcaatt
cgtacgacccataatcctgctagtgaacagactttgcagattgcggcagagttaggattg
ctagtccaagaagaggcttttgatacttggtatggaggtaagaagccttacgattacggt
cgtttctttgaaaaagatgccactcacccagaggctcaaaagggagaaaaatggtctgat
tatgacttacggacaatggtagaaagaggtaaaaataacccggccatcgtcatgtggtct
atcggaaatgaaatcggtgaggctaatggagatgctcattctttagcgactgttaaacgc
ctggtcaaggtcattaagtcagttgataaaactcgctatgtcacgatgggggcagacaaa
ttccgctttggtgatggtagtggtggccacgaaaaaattgctgatgagctagatgcagtt
ggttttaactattcagaagataattacaaagccttgcgtgccaaacatccaaattggttg
atttatggttctgaaacgtcttctgcgactcgtacacgtggtagctatttccatccagag
caagaatgggttggaagcaatcagtcttggcgaaactatgaacaatcggactatggaaat
gaccgagttggctggggtaaaacggcaacagcttcttggacttttgaccgagataatgct
ggttacgcaggacaatttatctggacaggaacagactatatcggtgaaccaactccttgg
cacaaccaaaacagcactcctgtaaagagttcttatttcggaatagtggatacagctggt
attcctaaaaatgactattacctttaccaaagtcagtgggtttctgttaagaaaaaacca
atggttcacctgcttcctcactggaattggcaagatcaggaattagcagacaatgttgca
gatgctgaaaataaaataccagttcgtgcatactccaatgctgctagtgttgaattattc
ttgaacaaccaatctttgggactcaagaaatttaataaaaaagagacaagtgatggccgt
agttaccaagaaggggccaatcctcaagaactttaccttgagtggaaagtggcatatcag
ccagggactctggaagcagtagctcgtgatgatcaaggtaaagaaattgcccgagacaag
attgtaacagcaggtcaacctgcaggagtgcgcttggttaaggaagagcacgctattgca
gcagatggaaaagacttgacctatatctactatgaaattgtagatcgtgatggcaatgtc
gtaccaactgctaataaccttgttcgtttccaattgcatggacaaggtcagctagtcgga
gtagataatggagaacaggctagccgtgaacgttacaaggaacaagcagacggctcttgg
attcgcaaagcctttaatggtaaaggggttgccattgttaaatcaacagaccaagcaggg
aaattcaccttaacggctcattctgatttattaaaatcggaccaggtgactatctttact
ggaaagaatgatcagaaagacaagacagttttagggacggaagtgccaaaagttcgtaca
gttttgggacaagctccaagcttgccagcgacagttccttttgtttacagtgacggaagt
cggactgaacagcctgtgacttggtcacaagcagatgttagtcattcaggcattgtaacc
gtcaaaggagagtcagaaggccgtcaggtagaagctcgtgttgaagttctagccgttgaa
agagagctaccagttatcaaacgagtggcaccagggacagatttgagtgctgtggataag
tcagttgctcttgccttaactgatgggagtcttgaacattatgatgtggataaatgggaa
attgcgccagaagataaggaaaaactttctgtcccaggttcccgcattcaaatgactggg
caacttgcaggtacaaaggtttcagcaaccttactagtgacagatagggaagcagaagca
cctgtgaatccagttgtaactcttgacggtgattctgtaacaggtctaactagtcagaaa
ccggttcattaccatagcctggcttatggatctcaacttcctttagtagccgcgacagct
gaaaatgcagatgtcacggttgttcaagctagtgttgcaaatgggttgcgggccagcatt
tatgttcaacctaaggatggcggtaccctacagacctatgctgttcagttcctagaagaa
gctcctaaaattgaacgtttgagcttacaagttgagcaagcgaatcatctaaaagaggat
cagactgttcaattaactgttttggcccattatcaagacggtactcaggcagtcttacag
gctgataaggttgccttctctacaacaggagagggagaacttgctgttcgtaaaggaatg
cttgaattacacaagcctggaattgtcacactcaaagctgaatacgagggcgctgaaggt
caagtaaacttgacgattcaggctaatacagaaaataaaacggttcaatccgttcgtcct
gttagtgtggtaactgatttgcatcaagaaccaaatcttccaaccactgttactgttgag
tacgacaaaggattccctaaagttcataaagttacttggcaagcaatggctaaggaggaa
cttgatcgctaccatacttttgaagtagtaggaaaggtcgaaggtattgatcaaaaagcc
attgctaaagtctctgttgaagggatcattgcagtcgaagaagtcagtgttacgacaccg
attgcagaagcccctcacttgccagagagtgtacggacttaccactcaaatggtcaagtt
tcgtcagcaaaagttacttgggagcctattgcccctagtcaatatcaaaaagagggcgtc
tttactgtgtcaggacaggtggaaggaagttctttaccaactaaacttcatgtacgagta
tctgctcaaacagaaaatggtgctaacatctctgatcaatggacaggttcagaattgcca
cttgcttttgcttcagattctaacccgagcgattcagtatctaatgttaatgataaagtg
atttcttatacggatcagccagccaaccgttggactaactggaaccgtcgtgaagaagat
tcggtaggggttctatttggagattctggtatcttgactaaacggtcagtagacaaccta
aatgtagcctttcatgaagatcacggggttggggcacctaagtcttatgtgattgaatat
tatgttgggcaagctacgccaacagctccaaaaaatcctagctttgtagaaagcgaagag
catgtctttaatgatgatagcaattggaaacctgtgaccaatctgaaagctccagatcag
ctaaaagcaggtgaaatgaatcactttaactttgataaggtagatacctatgctgttcgt
attcgtatggtaagagcagatgacaaacttggaacctctatcacagaagttcaaatcttc
tcgaaacaagttgctccagctaagcaagcacagactaggatacaggtggcgggccaagat
ttgccaaactttaatccgaacttgacggactactatttagaagctaaggatggaaaggcg
gatgaagtaactgcaagtgttagcaataatggtctggcgactgttgtaccaagtgtccgc
gagggagatcctgttcgtgtcatcgtcaaggctgaaaatggagatattctcggtgagtat
cgcattcactttaccaaggacaaagatctattggcacgtaaaccaatagcgacagtaaaa
caagctcgcctgctccaactaggtcaaaatctagagttaccaagcaaggtccctgtttac
tttacaggggaaaaagactatgaagtgaaagatttggctgtcgaatgggaaccagttcca
gctgaaaacttatcaaaagctggtcagtttactgttcatggtcgtctggttggaagtaac
ctagctgtcgagctaagagttcgagtgactgataagttaggcgaatctgtatcagacaat
ccttactatgatgaaaatagcaatcaggcttttgcatctgaaacaaatgatgctgatcca
gattctcatgatcgagtggattatatcaacgacggggaccttgatgagggccgacgttgg
acaaattggtcagcgacaccatcagctaatccagatgtttcagcaggtgttatcttcaaa
gaaaacggtaagattgtcgaacggacagttaatcaagccaaactgcacttctttgccgat
agcggtacagatgctccgtctaaactagtcttagagcgctatgttggtccggactttgat
gttccaatatattattcaaactatcgagcttatgaatcaaatcacttgtttaataatcct
gataactgggagtccgttccttataatatgaagcaagatatccaggctggtacagaactg
acagcaacctttaatgctgtgaaatccaaggctatgagatggagaatggatagaaaagcg
aataagaatggagttgccttgattgagatgactttcttggcaccaagtgagttgcctaaa
gaaagtacaaaatcaaaaatcttgcttaatggcaaagaacttccagacttctctgcggag
cgcttagaatatcaagtgtcctatagtggtcaacgtcctaaagttacagtagaagaaaat
gaccaagtggcttcgactgttgtagatagtggagataaccgtttgccagtcttggttcga
cttctgtctgagagtggtaagcaggttaaggaataccgtattcaactgactgaagaaaaa
actacagctggtaaggtagaagccacagtccaagaagaacttccacgtctagaagtcgaa
gaaaaagaactttcttatcagacgattgaaaaagaagatgccaatctctaccttggggaa
agccgtgtagaagaagaggggcaaaatggtaaggaaagaatctttactgaagtttctcca
gatggtcagcgagtagaaaaactacgagaagtggttcaagatcccatcaatcgcgtcctg
cttgtcggcattaagaaaggaacagctcttccagaagatgatatcaaagatttggttctc
tatagaccagagcttctgatagaggaagaagaggttgatttccaagtgcaagagcgaaag
aatgatatgttgccagttggccaaacgcgtattatacaagaaggtcgtaaaggtattcgt
gtgaacttagtcgaacttgaaaatggtaaacgcactcttaaagaaagctacaataaatta
gaaacacaagatcagattctagaagtgggaactgccctttcagaagaaaaaccaaagtca
caagatacttataaagctcattcacaaacttctgagcaagacaaatatcagagtctagaa
gaaaaagttcaaggcaccaaagctatgaaagaggagcatacagaagctaaatctgaagca
gtgcagcttcaagcagaaaaagtcaaatcaaccgaaaatagccacttaccgaatacagga
agtcagtcagatcaagcagcgataaccacgggcttagctctcttgggcttaggcgcgagt
cttgtagcagggaaacgtagaaaagaagactga

DBGET integrated database retrieval system