KEGG   Streptococcus gordonii: SGO_1582Help
Entry
SGO_1582          CDS       T00594                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sgo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1635917..1637350)
Genome map
AA seq 477 aa AA seqDB search
MSTFKDGFLWGGAVAAHQLEGGWKEGGKGISVADVMTAARHGVPREITAGVVPGKYYPNH
EAIDFYHRYKGDIALFAEMGFKCFRTSIAWTRIFPKGDEREPNEAGLQFYDDLFDECLKY
GIEPVITLSHFEMPYHLVTEYGGWKNRQVIDFFVRFAEVVFERYKDKVKYWMTFNEINNQ
ANYQEDFAPFTNSGIVYKEGDDREAIMYQAAHYELVASARAVKVGHEINPDFQIGCMIAM
CPIYPATCNPKDILMAMKAMQKRYYFTDVHAFGQYPEHILKYWERKGIKVDFSEQDQEDL
LAGTVDYIGFSYYMSFAIDSHRENNPYFDYIETEDLVKNNFVEASEWEWQIDPEGLRYAL
NWFTDHYHLPLFIVENGFGAIDQVEEDGMVHDDYRIDYLGAHIREMKKAVVEDGVDLMGY
TPWGCIDLVSAGTGEMRKRYGFIYVDKDDDGKGTCERSPKKSFNWYKEVIASNGANL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatttaaagatggatttctctggggtggagctgttgcagcccaccaattggaa
ggtggatggaaagaaggtgggaaggggatcagcgtggctgatgttatgactgcagctcgc
cacggggttccgcgtgaaattacagcaggagtggtgccaggtaaatactacccaaaccat
gaggccattgatttttatcatcgttacaagggagatattgctctttttgcagagatgggc
ttcaagtgtttccggacttctattgcctggacccggattttccctaaaggggatgaaagg
gagcctaatgaagccggcctgcaattttatgacgacctttttgatgaatgcctcaagtat
ggtattgagcctgttatcactttgtctcactttgaaatgccttatcatctagtaaccgag
tatggtggttggaaaaatcgtcaggtgattgacttctttgtccgttttgcagaagttgtt
tttgagcgttataaggataaagtcaaatactggatgactttcaatgaaatcaataaccaa
gctaattatcaggaggattttgctcccttcactaactctgggattgtctacaaggaaggc
gatgatcgtgaagcaatcatgtatcaggctgctcattatgagctagtagcttcagcgcgt
gcagttaaggttggtcacgaaatcaatcctgacttccaaatcggttgtatgattgccatg
tgccctatttatccggctacttgcaatccaaaggatattctcatggctatgaaagctatg
cagaagcgctattactttacagatgtgcatgcatttggtcaatatcctgagcatattctc
aaatactgggaaagaaaaggaatcaaggtggactttagcgagcaggatcaggaagatttg
ctggcgggcacggttgactatattggctttagctactacatgtcctttgctattgactcc
catcgagagaataacccttacttcgactatatagagactgaagatttggttaaaaataac
ttcgtagaggcttctgaatgggaatggcagattgacccagaaggtctgcgctatgctctc
aattggtttaccgatcattatcatctaccgcttttcattgtggaaaatggctttggagct
attgaccaggtggaagaagatggtatggtacacgatgattaccggattgactatttgggt
gcccatatccgcgagatgaaaaaggccgtagtagaagatggtgtggatctcatgggctac
acgccttggggctgtattgacctagtatcggcaggtacgggtgaaatgcgcaaacgttat
ggatttatctatgtcgacaaggatgacgatggcaaaggaacctgtgaacgttcaccgaag
aagtcctttaactggtataaggaagtcatcgcatcaaatggggctaatctatag

DBGET integrated database retrieval system