KEGG   Streptococcus gordonii: SGO_1774Help
Entry
SGO_1774          CDS       T00594                                 

Definition
(RefSeq) zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SGO_1774
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_1774
  Lipid metabolism
   00071 Fatty acid degradation
    SGO_1774
  Amino acid metabolism
   00350 Tyrosine metabolism
    SGO_1774
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGO_1774
   00626 Naphthalene degradation
    SGO_1774
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SGO_1774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1848467..1849504)
Genome map
AA seq 345 aa AA seqDB search
MKKTVYTKAGQVGLVEVDRPQIEAPDDAIIRIVRTCVCGSDLWSYRNPDIEKSHQNSGHE
AIGIVEEIGEGITTVKPGDFVIAPFTHGCGECDACRAGYDGTCDRHVGNNWSDGVQAEYM
RFEFANWSLVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARVADVKPGDKVVVIGDGAV
GQCAVIAAKMRGASQIVLMSRHEDRQKMALESGATAVVAERGQEGIAKVREILGGGADAA
LECVGTEAAVDQALGVLHNGGRMGFVGVPHYNNRALGSTFAQNITVAGGAASVTTYDKQI
LLKAVLDGDINPGRVFTSSYKLEDIDQAYKDMDERKTIKAMIVID
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaactgtctatacaaaagctggtcaggttggtcttgttgaagtggaccgtccg
caaatagaggcgccagatgatgctatcattcgtatcgttcggacctgtgtctgtggctct
gacttatggagctaccgcaatccagacatcgaaaagagccatcaaaatagtgggcatgaa
gctatcgggattgttgaagaaattggtgaagggatcacaacggtaaagcctggtgatttt
gttattgctccctttactcatggatgtggggaatgtgatgcctgtcgggcaggatatgac
ggtacctgtgatcgtcatgttggtaataactggtcagacggggtgcaagcggagtatatg
cgcttcgaatttgccaactggtccctggtcaaaatcccagggcaaccctcagattacaca
gaaggtatgctaaaatctctcttgacgctagctgatgtcatgccaacaggctatcatgct
gcgcgtgttgctgacgtcaagccaggtgataaggtagttgtcattggtgacggagcggtt
ggacaatgtgcagtaattgctgctaaaatgcgtggggcatctcaaatcgtcctcatgagc
cgtcacgaagaccgacaaaagatggcgctagagtcaggagcgacagctgttgtagctgaa
cgtggtcaagaaggaattgctaaagttcgtgaaatccttggaggaggagcagatgcagct
ctcgaatgtgtcgggacagaagcagctgttgaccaggcactgggagttcttcacaatggt
ggtcggatgggctttgttggagttcctcattataacaaccgtgctcttggatcgactttc
gcccaaaacattacagtggcaggcggagcagcctccgtcacgacttacgataagcaaatt
ttgctcaaggctgtccttgacggcgatatcaatccaggacgtgtcttcacttcaagttat
aaacttgaagatattgatcaagcctataaagacatggatgaacgcaagaccattaaggct
atgattgtgattgattag

DBGET integrated database retrieval system