KEGG   Streptococcus gordonii: SGO_1914Help
Entry
SGO_1914          CDS       T00594                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sgo  Streptococcus gordonii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sgo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1984966..1985931)
Genome map
AA seq 321 aa AA seqDB search
MAQKKIDVRRLVPDGKTGLCGILNVTPDSFSDGGKYNTVEFALEQARYLIREGAQMLDIG
GESTRPGSHYIEIEEEIERVVPVIEAIRKESDVLISVDTWKAPVAKAALAAGADIVNDIT
GFLGDEGMAPVVAESSAGAILMFNPVMARPHHASSLIFPKFGFQDIFTDQELSKFAHSDI
VDLMWAFFDKSLARAKAAGIEKKSLMLDPGIGFGLTKRENLILLQHLEDIHRAGFPIFLG
VSRKRFVVNILEDAGVEVDPETDLGYQNRDIASSHLTSIAASQGVEMLRVHDIPYHKMAV
EIGDAIRLANRAEDLTLGQYK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaaaaaattgatgttcgaagactcgtcccagatgggaagactggtttgtgc
gggattcttaatgtaaccccagattctttttcggatggtggcaaatacaacactgtagaa
tttgctttagagcaagcgcggtatctgatccgagaaggtgcccagatgttggacattggg
ggggagtccacgagacccggtagccattatattgagattgaagaagagatcgagcgagtg
gttccagtgattgaggctattcgcaaggaaagtgatgtcttgatttcggtcgacacctgg
aaagcacccgtagcgaaagcggccctagcggccggtgcagatattgttaatgatatcact
ggatttttaggcgatgaaggaatggcgccagtggtggctgagtcttctgctggagctatt
ctgatgttcaatccggttatggctcgacctcaccatgctagctcattgatctttcccaag
tttggctttcaagatatttttacagaccaggaattatcaaagtttgcgcattcagatatt
gtagatttaatgtgggccttctttgataaatccttggctagagcaaaagcggcaggaata
gagaagaagagcctcatgctggatccaggtattggttttggtctgaccaagcgagaaaac
ctaattctgttacagcatctggaagatattcatcgagctggttttccaatcttccttggt
gtttctcgcaaacgcttcgttgtaaatatattagaagatgcaggtgttgaggtggatcca
gagacagatttgggctaccaaaatcgtgatatagcttccagtcatttgaccagcattgca
gccagtcaaggggtagaaatgctacgagttcatgatattccttatcataaaatggcggtg
gagattggtgatgcgattcgtttagccaatcgcgctgaagatttaaccttggggcaatac
aaataa

DBGET integrated database retrieval system