KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0038Help
Entry
SpiGrapes_0038    CDS       T01673                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SpiGrapes_0038
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiGrapes_0038
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SpiGrapes_0038
Enzymes [BR:sgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SpiGrapes_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
38238..39509
Genome map
AA seq 423 aa AA seqDB search
MNFVSTRKKSPAVSASEAILQGLAPDGGLYIPETFPSLENLRINEISSYPELAFEVLYPF
FETDILKDDLAEICIEAFNFPVPLVQVKDKQTILELYHGPTAAFKDFGARFLACAMEKLL
EKQERKLTILVATSGDTGGAVAAAFANRKGIEVKVLFPKGRVSKRQKQQLTCWGGNIKAY
EVDGSFDDCQKMVKDAFMDTELKETWGLSSANSINLGRLLPQSVYYVYAAHLFSQSFGIK
PTFIIPSGNVGNSCGAYWAFSMGAPIERIALAVNANKTIPDYLEEGEYKPRSSVATLANA
MDVGSPSNMERLFALYGDIETFRRQVSAWSVDDETIKQTIKEVYDENGYILCPHTATAER
VRRDHFADKGTIVVSTAHPAKFEAVVEPLIGKEVPVPENLAALFDKKSEYKSVGCNYKEL
FVD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgtatctacgagaaagaaatcaccagctgtcagtgcaagtgaagcaatattg
cagggacttgccccagatggaggactctatattccggaaacgtttccctccttggaaaac
ctgaggatcaatgaaatttcatcgtatcctgagcttgcctttgaagtactctatcccttt
ttcgaaaccgatatactcaaagatgatcttgcagagatttgtatcgaggccttcaatttt
cctgtcccgcttgttcaggtaaaggacaaacagaccattttggagctctaccatggacct
acggcagctttcaaagactttggtgcccgtttccttgcctgtgccatggaaaaactgctg
gagaagcaggaaagaaaacttaccattttggttgcaaccagcggggataccggtggggct
gttgccgcggcctttgccaaccgcaagggaatcgaggtaaaagtcctgttccccaaagga
agggtgagcaaacggcagaaacagcaattgacctgctggggtgggaatatcaaggcctat
gaagtagacggttcctttgatgactgccagaaaatggtcaaggacgcttttatggatacc
gagctcaaagaaacctggggcctgagcagtgccaatagcatcaatttggggagattgctt
ccccagagtgtctattatgtctatgctgcgcacctgttctcccagagctttggaataaag
ccgaccttcatcattcccagcggaaacgtagggaacagttgcggtgcctactgggctttt
tccatgggagccccgatagaacgcatcgcgcttgcagtgaatgcaaacaagaccatcccc
gattatcttgaagaaggtgaatataagccaaggagcagtgtggcaacccttgccaacgct
atggatgtaggatcccctagcaatatggaacggcttttcgccctgtatggtgacatcgag
acgttccgcaggcaagtcagtgcctggtcggtcgatgacgagaccatcaagcagacaatc
aaagaagtgtatgacgaaaacgggtatatcctgtgtccccataccgctacagccgagcgg
gtgaggcgagaccactttgccgacaaagggacgattgttgtctctaccgctcatcctgca
aagtttgaagctgtagtcgaaccccttattggcaaagaggttcccgtccccgagaacctt
gctgccttgttcgacaaaaagagtgaatacaaatcagtgggctgtaattacaaagaactt
tttgttgactga

DBGET integrated database retrieval system