KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0360Help
Entry
SpiGrapes_0360    CDS       T01673                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpiGrapes_0360
   01230 Biosynthesis of amino acids
    SpiGrapes_0360
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiGrapes_0360
   00051 Fructose and mannose metabolism
    SpiGrapes_0360
   00562 Inositol phosphate metabolism
    SpiGrapes_0360
Enzymes [BR:sgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SpiGrapes_0360
Exosome [BR:sgp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SpiGrapes_0360
  Exosomal proteins of bladder cancer cells
   SpiGrapes_0360
  Exosomal proteins of melanoma cells
   SpiGrapes_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
386013..386765
Genome map
AA seq 250 aa AA seqDB search
MRKPYIAGNWKMNMTPSAGAAFAKELAKALEGVDTKVMIAPPFVTIPAVLEAVKGSNIIV
AAQNMNDHLSGAYTGEVSPAMLKDLGVTNVILGHSERRAIYGETDEFINKKVLLALSESM
DIDLCVGETLEEREAGKLEEVLTRQVSVGLSGVSAEQMSHITIAYEPVWAIGTGKTATPE
DADDAHAFIRSLVEKLYTKGVAEELIIQYGGSVKASNVKSLMSKKHIDGALVGGASLSVE
QFLPIVTFDK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccctatatcgcaggaaactggaaaatgaacatgaccccttcagctggtgct
gcttttgcaaaagagcttgccaaagcacttgaaggtgtagataccaaagtaatgattgca
ccacctttcgttaccatccctgctgtcctcgaggcagtaaagggcagtaatatcattgtt
gctgctcagaacatgaacgatcatctcagtggtgcctacactggtgaggtaagtcctgct
atgctcaaagacctcggggtaaccaatgtcattctcggacatagcgagagaagggcaatt
tatggcgaaaccgatgaattcatcaacaaaaaagtgttacttgccctgagtgaatccatg
gacattgatctttgcgtcggagagaccctcgaggaacgcgaggctggtaaacttgaagaa
gttcttacccgccaggtgtctgtcgggctttctggtgtcagcgctgaacaaatgagccac
atcaccattgcctatgagcctgtatgggcaattgggactggaaagaccgcaactccagag
gatgcggatgatgctcatgcctttattcgctctcttgtagaaaaactctataccaagggt
gttgcagaagagctaataatacagtatggtggttcagtgaaggcttccaatgtgaagtct
ttgatgtccaagaaacatatcgatggagctcttgttggtggtgcttctctctctgtagag
cagtttctcccgattgttacctttgataagtga

DBGET integrated database retrieval system