KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0399Help
Entry
SpiGrapes_0399    CDS       T01673                                 

Definition
Holliday junction DNA helicase, RuvA subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SpiGrapes_0399
Enzymes [BR:sgp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SpiGrapes_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
431587..432219
Genome map
AA seq 210 aa AA seqDB search
MINAIIGDIVTISEGEVILRAGYVEYRLLITGQTSSRLSQLQVEDRQKVRLLSVLHHRED
SMTLFGFFDEQERDAFTQLQSVSGIGSKQALKILSGISVKQLALALDSGNVKLLSSIPGI
GPKTGQKMILALRNMLVLDDEKTISPSSSKNGKLKKWTDILDALFDMGYDRKRSEEVLDT
LLIQLGPQLESLGRHEAEELLFRNAIVALG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgcaatcatcggagacattgtcaccatcagtgaaggggaagtcatactgcgt
gcgggttatgttgaataccgcctcctcattactggccagacatccagcaggctcagccag
ttgcaggtagaagaccgccagaaagttcggttgctgtctgtattgcatcaccgtgaagac
agcatgacactctttggtttcttcgacgaacaggaacgggatgcattcactcagttgcaa
agtgtttccgggatcggctcaaaacaagccctgaaaatactttccggtatcagcgtgaag
caattggcccttgcccttgacagtggaaatgtaaaactgctttcctcgattccgggtatc
ggcccaaagacaggccagaaaatgattctcgcactcaggaatatgctggtgcttgacgat
gaaaaaaccatttccccgtcatcctccaaaaacggaaagctcaagaaatggacagatatt
ctcgatgccctgtttgatatgggctatgaccgcaaacgcagcgaggaagtcttggatacg
ctgcttatccagttaggaccacagcttgagtccctgggtaggcacgaagcggaggagtta
ctcttccgcaatgcaatagttgcattggggtag

DBGET integrated database retrieval system