KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0563Help
Entry
SpiGrapes_0563    CDS       T01673                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SpiGrapes_0563
  Lipid metabolism
   00561 Glycerolipid metabolism
    SpiGrapes_0563
   00600 Sphingolipid metabolism
    SpiGrapes_0563
Enzymes [BR:sgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SpiGrapes_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(613586..614941)
Genome map
AA seq 451 aa AA seqDB search
MKIVLVGAGSAQFGYGMLGDIFTSKTLAGSEITLLDINDKALDSVFRTAKAFIEQHALKY
SVHATTDRKVAFKNADFIISSIEVGNRFQLWDEDWKIPLQYGVHQVYGENGGPGGVFHSL
RIGRVILEIVKDAVEICPDAWIFNFSNPMTSICTTVNRAYPEAKFVGMCHEIGWLGRWLP
RMLNMKLEDLHFRAAGLNHFSCMLELTDRKTGKDLYPEVLKKAEAFFEREPGYSDLLDEY
RRTGNLDAAEKFEKGHSDKKSSYIWADRHLVQFMLKNYRLLPITTDSHFGEYISWAWDVA
DHRGILDFYDVYKIMLTQELRHDIKLETAERVVPIIDGILNDSGYEEAAVNVQNNGLLED
LPSWIAVEVPAIINKDGVNGIKMPNIPKGYLSLLRSYTSVYDLTAEAIIHGKKDYVIQAM
LANPVVHQASQIEAMVDRMIDQQQKWLGYLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttctagtcggtgcaggtagcgcccaattcggttatggaatgcttggcgat
atatttaccagcaagacgttggcaggcagtgagattaccctgctcgatatcaatgataaa
gccttggacagtgtgtttcgtactgcaaaagcctttatcgaacagcatgcactcaaatat
agtgtgcacgccacgacagaccggaaagtcgcattcaagaatgccgactttatcatttcc
tccattgaggtagggaaccgtttccaattgtgggatgaggactggaaaatcccgttgcag
tacggggtgcatcaggtctacggtgaaaacggcggtcccgggggggtctttcattccttg
cgtatcggccgggtaatccttgagattgtaaaagatgcagtggaaatatgccctgatgct
tggattttcaatttttcaaatcctatgacttccatctgcaccacggtcaaccgggcctat
cctgaggccaaatttgtcggcatgtgccatgaaatcggctggcttggacgatggttgccc
cgcatgctgaatatgaaacttgaggacttgcatttcagggccgcagggctcaatcatttc
agctgcatgcttgaactgacagacagaaagactggtaaggatctctatcctgaggttctg
aaaaaagcagaggcttttttcgagcgtgaacctgggtacagtgacttgctggacgagtac
cgcaggaccggaaacctcgatgctgcggaaaaatttgaaaaagggcattcagataaaaaa
agcagttatatctgggcagaccggcatctggtccagtttatgctcaaaaactaccggttg
ctccccattacgacagacagccatttcggcgagtatatatcttgggcctgggatgttgcc
gaccaccggggcatcctcgatttctacgatgtgtacaaaataatgcttacgcaagaactg
cgccatgatataaaacttgaaacagctgaaagggttgtcccgatcatcgatggaatactc
aatgacagtggctatgaagaagctgcagtaaacgttcagaataacggccttcttgaggat
ttgccctcctggattgccgttgaagtccctgcaattatcaataaagacggggtgaacggt
atcaagatgcccaatattcccaagggctatctctccttgctcaggtcctatacgagtgtg
tacgatttgactgccgaagcgattatccatgggaagaaagactatgtaatccaagccatg
ctggctaatcccgtggtacatcaggcctcgcaaatcgaagcgatggtagatagaatgatt
gaccaacagcagaaatggcttggatacctgaagtaa

DBGET integrated database retrieval system