KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0572Help
Entry
SpiGrapes_0572    CDS       T01673                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SpiGrapes_0572
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SpiGrapes_0572
Enzymes [BR:sgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SpiGrapes_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624002..625327
Genome map
AA seq 441 aa AA seqDB search
MKEYQLRSSNVACVWKETAGQETTSSYGVALNGQSYQGMLGFGGCFNELGYTALEKLDSG
HRKNLMEELFKEASFNVCRLPIGANDYAKNWYSLDECPGDFDLKEFSIERDKQILIPYIK
EALAVNKDMVLFASPWSPPTWLKNPPVYNWGKLIWEKQYLETYAQYFVRFVQEYAKAGVQ
VNQIHVQNEPVANQKFPSCMWTGEELKVFIRDYLGPAFREAGIDSEIWLGTINAPGCDYR
KLLFDKWAEEDYDYFANTVLSDPKALSFISGVSYQWGGKIAIQRTFESWWPRIRLMQSEN
ECGFADNTWDYAFYTWTMLKHYLTNGAESYLYWNIVLEEGGFSTWGDPQNSMVTVHQDGT
YTLNPDYYIMKHFSSIIQRGAVRLGLTGPWAADTLIFCNPDGSYAVELFNPFETEKEVVV
QLDGKSIAFTLPGRSVSSVVL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatatcaattgagaagttctaatgttgcatgcgtctggaaggaaaccgcaggc
caggaaacaaccagttcatatggggttgccttaaatgggcaatcctaccaaggcatgctg
gggttcggagggtgtttcaatgaactgggctatactgcattggaaaagctcgattcagga
caccgaaaaaacctgatggaggagcttttcaaagaagcctctttcaatgtctgccgttta
cctataggggcaaacgactatgcaaagaactggtattcactcgatgaatgcccaggagac
ttcgacctgaaggaattttccatcgagcgggataaacagatactcattccttatatcaag
gaagccttggctgtgaacaaggatatggtattattcgcttctccttggagtccaccaact
tggttgaagaaccctccggtatacaattggggtaaattaatctgggaaaaacagtatttg
gaaacctatgcccaatatttcgtacgttttgtccaggaatatgcaaaggcaggagtccag
gttaatcaaatccatgtacagaatgaaccagtggcaaaccaaaagttcccttcctgcatg
tggacaggagaggagctgaaagtctttatcagggattaccttggaccagccttcagagaa
gctggcatcgattccgagatttggctgggtacgatcaatgccccagggtgtgactacagg
aagttgctctttgacaaatgggcagaggaagattatgactattttgccaatacggtactt
tcagaccccaaggccttgagcttcatcagtggcgtttcgtatcaatggggcgggaagatt
gcaatccagaggacgttcgagagctggtggccccgtatccggctgatgcaatcggaaaac
gagtgcggtttcgctgataacacctgggactatgccttctatacatggacaatgctcaaa
cactacctgaccaacggggcggaaagctacttgtactggaacatcgtacttgaagagggt
ggattcagcacctggggggatccccagaattccatggtgacagtacatcaagacggtaca
tacaccctcaatcctgattactatatcatgaaacacttttcctccattatccaacggggg
gccgtacgcttaggtctcactggtccttgggccgccgataccttgattttttgcaacccc
gatggctcctatgctgttgaactcttcaatccctttgaaacagagaaagaagtggtggta
cagttggacgggaaatcaatcgcgtttaccctgccaggacgatcagtcagtagcgtggta
ctttga

DBGET integrated database retrieval system