KEGG   Sphaerochaeta pleomorpha Grapes: SpiGrapes_0573Help
Entry
SpiGrapes_0573    CDS       T01673                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sgp  Sphaerochaeta pleomorpha Grapes
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sgp00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sgp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
625330..626667
Genome map
AA seq 445 aa AA seqDB search
MHTNLYVTSRGEGTPLEKMSIIPGIIDDGGIELNIINIYQQVTFQKLQGFGGAITEAVGS
VLAALPEEQASTILRSCFSSEGLAYRFVRTSIDSCDFSLSEYCAGKQDESFSLERDEISI
IPWIKKAYEIAEEAFAVMLSPWSPPAYMKSNGQRCQGGSLKDEYKTQWAEYICRYIKAYR
DQGIRVACLSIQNEPNANQKWESCLYTGAEEKDFLQTYLYPALQKSHLEDIEIFVWDHNK
ERLFDRAAACIDEKTDPMVAGFAFHWYSGDHFDALRLVKKRYPSKRLLFSEGCIEYSRYD
KGNQLYNAQKYGHEIIGNLNAGMDTFIDWNIVLESNGGPNHCNNFCEAPIFVNRETNEII
YNLSYRYIWHFSHFIQPGAVHIASTGFDSTVESVAFRNPEGSYVVVIMNRSQKEQPINLR
MAGSLYSFVLAKDSIATAVLSAGDQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaacctttatgtcacctcaaggggagagggaactcctcttgaaaaaatgtcg
attatccccggaattatcgatgatggaggaatcgaactgaacatcatcaatatatatcag
caggtaacctttcaaaagcttcagggttttgggggagcaattaccgaagcagtaggttct
gtcctggctgctttacccgaagaacaagcctcaaccatccttcgcagttgtttcagctcc
gaaggattggcgtaccgttttgtcaggaccagcattgacagttgtgatttttccctctct
gaatactgtgcaggaaaacaggacgaaagtttttccctggaaagagacgagatttccatt
attccctggataaaaaaggcttatgagattgcagaggaggcctttgctgtcatgcttagt
ccctggtcaccccctgcctatatgaaaagcaacggccaacgctgccagggcggttccttg
aaagacgaatataagacgcaatgggccgagtatatatgtcggtatatcaaggcataccgt
gaccaagggattcgagttgcatgcctatctatacagaatgaacccaatgcaaaccagaaa
tgggaaagttgcctttacacaggagctgaagaaaaagattttttgcaaacctacctctac
cctgctctacagaagtcacatttggaggatattgaaatttttgtgtgggatcataataaa
gaacgtctttttgaccgtgcagcagcatgcatcgacgaaaagaccgacccgatggtggcg
ggttttgccttccactggtatagcggtgaccatttcgatgccttgcgtctggtcaaaaag
cggtatccctccaagcggttgctcttcagcgaagggtgcatcgaatatagccgttatgac
aagggcaaccagttgtacaatgcccagaagtatgggcatgagataatagggaacctgaat
gcaggtatggatacgttcatcgattggaatatcgtacttgaaagcaatggagggccaaat
cactgtaacaacttctgcgaggcgcctatttttgtcaatcgggaaaccaatgagattatc
tataatctttcttaccggtatatctggcatttcagccatttcatacagcctggggctgta
catatagcctccacaggttttgactccacagttgaatctgtggctttccgaaaccctgag
ggttcttatgtcgtggtaataatgaataggagtcagaaagagcagcctatcaatttgcgt
atggcagggtctttgtattcctttgtccttgccaaggacagtattgcaacagcggtgctt
tctgcaggggatcagtga

DBGET integrated database retrieval system