KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0648Help
Entry
SpiGrapes_0648    CDS       T01673                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SpiGrapes_0648
Enzymes [BR:sgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SpiGrapes_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
710886..712001
Genome map
AA seq 371 aa AA seqDB search
MKRAILLGCTGSIGTTAITAIRDKNLDIQVVALSAHTNAPKLFSLAESLSVEAVCLTGGN
CPPSSHFKTYSHTEGLKQMLRTFEADIILNAIAGFDGLEATIACIECGRDVALANKESVV
CGGSFLFDLAKQHGVNIIPVDSEHSALYELMKHRSKDDIESLIITASGGPFRDLPYDEFD
TITVEQALRHPTWNMGRKITIDSATLANKALEVIEASYLFGFPSEKIEVVIHPQSIVHSM
VRLKDGAVYAQLGTPDMTLPIVNALIDGSERLVKPLSFSHLQLTFDEPDFKRFPLLSEAF
SILKRRGSTPIAFNAADEVAVHAFLNKQCSYAKMVSCVLKTMDNDWDLHVSNFAETVEID
RKARALARSFL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcaattctcctcggatgtaccggaagtataggcactacggccattactgca
atccgcgataaaaaccttgacattcaggtggtcgcgctatctgcacatacaaatgcccct
aagcttttttctctggctgaaagcctatctgttgaagccgtttgcctgacaggagggaat
tgtcctccctcttcgcattttaaaacctatagtcacacagaaggcctgaagcaaatgctt
cgtacttttgaagcagatataattctcaatgccatcgccggttttgatgggttggaggca
actattgcctgcatagaatgcgggagagacgtcgctttggccaataaggaaagtgtcgtt
tgcggagggtctttcctttttgacctggcaaaacaacatggcgtgaacatcattcctgtc
gatagcgaacatagtgccttatatgaattgatgaaacatcgatcaaaggatgacatagag
agcctcatcattacagcgagcggaggacccttcagagacttgccctatgatgaattcgat
accataaccgtcgaacaggcactcagacaccctacttggaatatgggcaggaagattacc
atcgacagtgcaaccttggctaacaaagccctcgaagttatcgaggcttcctatctcttt
ggattcccttccgaaaaaatcgaagtagtcatccacccacagagtattgtccattctatg
gtcagactcaaggatggggctgtctatgcacagctcgggacccctgatatgaccttgcca
atcgtaaatgcactcatagatgggtcagaaaggttggtaaaaccactctccttttcccat
ctgcaacttaccttcgatgagccagatttcaagagatttccccttctgtccgaagctttc
tccatcttgaaacgaaggggttcgacaccgattgctttcaatgcagcagatgaagttgcc
gtgcatgcttttctaaacaagcaatgcagttatgcaaaaatggtttcctgcgtattgaaa
acaatggataacgactgggacctgcatgtttccaattttgcagagacagtcgaaattgat
agaaaagcgagggccctcgcaagaagtttcctatga

DBGET integrated database retrieval system