KEGG   Sphaerochaeta pleomorpha Grapes: SpiGrapes_0648Help
Entry
SpiGrapes_0648    CDS       T01673                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sgp  Sphaerochaeta pleomorpha Grapes
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sgp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
710886..712001
Genome map
AA seq 371 aa AA seqDB search
MKRAILLGCTGSIGTTAITAIRDKNLDIQVVALSAHTNAPKLFSLAESLSVEAVCLTGGN
CPPSSHFKTYSHTEGLKQMLRTFEADIILNAIAGFDGLEATIACIECGRDVALANKESVV
CGGSFLFDLAKQHGVNIIPVDSEHSALYELMKHRSKDDIESLIITASGGPFRDLPYDEFD
TITVEQALRHPTWNMGRKITIDSATLANKALEVIEASYLFGFPSEKIEVVIHPQSIVHSM
VRLKDGAVYAQLGTPDMTLPIVNALIDGSERLVKPLSFSHLQLTFDEPDFKRFPLLSEAF
SILKRRGSTPIAFNAADEVAVHAFLNKQCSYAKMVSCVLKTMDNDWDLHVSNFAETVEID
RKARALARSFL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcaattctcctcggatgtaccggaagtataggcactacggccattactgca
atccgcgataaaaaccttgacattcaggtggtcgcgctatctgcacatacaaatgcccct
aagcttttttctctggctgaaagcctatctgttgaagccgtttgcctgacaggagggaat
tgtcctccctcttcgcattttaaaacctatagtcacacagaaggcctgaagcaaatgctt
cgtacttttgaagcagatataattctcaatgccatcgccggttttgatgggttggaggca
actattgcctgcatagaatgcgggagagacgtcgctttggccaataaggaaagtgtcgtt
tgcggagggtctttcctttttgacctggcaaaacaacatggcgtgaacatcattcctgtc
gatagcgaacatagtgccttatatgaattgatgaaacatcgatcaaaggatgacatagag
agcctcatcattacagcgagcggaggacccttcagagacttgccctatgatgaattcgat
accataaccgtcgaacaggcactcagacaccctacttggaatatgggcaggaagattacc
atcgacagtgcaaccttggctaacaaagccctcgaagttatcgaggcttcctatctcttt
ggattcccttccgaaaaaatcgaagtagtcatccacccacagagtattgtccattctatg
gtcagactcaaggatggggctgtctatgcacagctcgggacccctgatatgaccttgcca
atcgtaaatgcactcatagatgggtcagaaaggttggtaaaaccactctccttttcccat
ctgcaacttaccttcgatgagccagatttcaagagatttccccttctgtccgaagctttc
tccatcttgaaacgaaggggttcgacaccgattgctttcaatgcagcagatgaagttgcc
gtgcatgcttttctaaacaagcaatgcagttatgcaaaaatggtttcctgcgtattgaaa
acaatggataacgactgggacctgcatgtttccaattttgcagagacagtcgaaattgat
agaaaagcgagggccctcgcaagaagtttcctatga

DBGET integrated database retrieval system