KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0883Help
Entry
SpiGrapes_0883    CDS       T01673                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SpiGrapes_0883
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiGrapes_0883
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SpiGrapes_0883
Enzymes [BR:sgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SpiGrapes_0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
956214..957398
Genome map
AA seq 394 aa AA seqDB search
MKNGRFGQFGGQYIPETLMHAVIELDTAYNHFKDDPEFQAELSLLYSEYAGRPSLLTYAE
HMTKDLGGAKIYLKREDLNHTGSHKINNVLGQCLLAKKMGKRRVIAETGAGQHGVATATV
AALMGLACEVFMGKVDCDRQALNVYRMELLGATVHPVTSGTMTLKDAVNETMKEWTRRIE
DTHYVLGSVMGPHPFPTMVRDFQKIIGKEVRSQLLKKEGKLPDYLLACVGGGSNAMGLFY
DFIEEPTVQLIGCEAAGKGIDTRLHAATIAKGTLGIFHGMKSYFCQDSYGQIDEVYSISA
GLDYPGIGPEHADLYEKGRASYVPVTDDQAVEAFEYLSRMEGIIPAIESAHAVAYAKILA
PTLGKDKVLVINLSGRGDKDVAAIARYKGEALYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacggacgattcggccagttcggtggccaatacatacctgaaaccttgatgcat
gcagtcatcgaactagacactgcctataaccatttcaaggatgacccagaattccaggcg
gaactgtctctcctctacagcgaatatgcaggaagaccttccttgcttacctatgccgag
catatgaccaaagatttgggcggagccaagatctacttgaaacgggaagacctcaaccac
accggctcccataagatcaacaacgtattgggccagtgcctgctggccaagaaaatgggc
aagcggagggtaatcgccgagactggggccgggcaacatggcgtggcaaccgctaccgtg
gcagcgctcatgggccttgcgtgtgaagtcttcatgggcaaggttgattgtgaccgtcag
gctttgaacgtataccgcatggaattgcttggagctactgtccatccggtaaccagcgga
acgatgacgctcaaagacgctgtaaatgaaaccatgaaagaatggacacggcgcatcgag
gacacccactatgtgttaggctcggtaatgggaccccatcccttccccaccatggttcgc
gacttccagaaaatcatcggaaaggaagttcgctcccaattgcttaaaaaggaaggaaaa
ctccccgactatctgctcgcctgcgtgggtggcggatcgaacgccatgggattgttctat
gatttcatcgaggaaccgacggtacaactcatcggatgcgaggcagcgggaaaaggtatc
gatacgaggctgcatgcagcaacgatagcaaagggtacactgggaatcttccatggaatg
aaaagctatttctgccaggattcctacggccagatagatgaggtgtattcgatcagcgca
gggctcgactacccgggtatcggaccggaacatgcagatctgtatgagaagggaagagcc
agttatgtaccggtaaccgatgaccaagcggtcgaagccttcgagtacctttcgcggatg
gaaggaataatccctgcaatcgaaagtgcccatgccgttgcctatgcaaagatacttgcc
cccaccttgggaaaagacaaggtactggtcatcaatctcagcggtcgcggagacaaagat
gtggctgcgattgcccgttacaaaggagaagcgctgtatgagtag

DBGET integrated database retrieval system