KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0884Help
Entry
SpiGrapes_0884    CDS       T01673                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiGrapes_0884
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SpiGrapes_0884
Enzymes [BR:sgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SpiGrapes_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
957391..958170
Genome map
AA seq 259 aa AA seqDB search
MSRIANAFLKGKAFIPFITCGDPDLETTKALVLAMEKSGADLIELGIPFSDPIAEGPVIQ
KADKRALQSGTTADRIFSLVAEIRLETDIPLVFMTYINPIFTYGKARFLTRCKEVGIDGI
IVPDLPYEEQDELKGFCSESGVTLISMIAPTSRERIQMVAKEAEGFLYCVSSLGVTGERS
AIGDAAMMMVEEAKKATTIPCCIGFGISNAEQAKAMASFADGVIVGSAIVRLIAENGKDS
IQPVSKFVSAMKTAIATTA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggatagcaaacgcctttctcaaggggaaagccttcatccccttcattacctgt
ggagaccccgacctggagacgacaaaagccttggtccttgccatggagaaaagtggtgcc
gacctcatagaactgggcattcccttctcagaccccattgcagagggtcctgttatccaa
aaagcggataaacgagctttgcaatcggggacaactgctgacaggattttctccctggtt
gcagagattcgcctcgaaactgacattcccttggtgttcatgacctatataaacccaata
ttcacctacggtaaagcccgctttttaacgcgttgcaaagaagtgggaatcgacgggatc
atagtgccagacctaccctatgaggaacaggatgaactcaaaggtttctgctctgagtct
ggcgtcaccctcatcagtatgatcgcccctaccagcagagagcggatacagatggtagcc
aaagaagctgagggttttctctactgcgtatcgtctctaggggttaccggagagcgttca
gccataggtgatgctgcaatgatgatggtagaagaggcaaagaaggctactacgatcccc
tgttgtatcggctttggtatttccaatgcagagcaagccaaggccatggcttcctttgcc
gatggggtaatcgtcggttcagctatcgtacggctgatagcagagaacggaaaagacagc
atccaaccggtttccaaatttgtcagtgcaatgaagacggcaatagcaacgactgcatag

DBGET integrated database retrieval system