KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0888Help
Entry
SpiGrapes_0888    CDS       T01673                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SpiGrapes_0888
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SpiGrapes_0888
Enzymes [BR:sgp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SpiGrapes_0888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961316..962098
Genome map
AA seq 260 aa AA seqDB search
MNILQQLAQSTKNRYKGKEVNRPLALLKEQAELCTPLSPAFPFARALRKEGLSVICEIKK
ASPSKGIISSDFPYLEIAKEYAIGGGDAISVLTEPSLFLGKDRYLSEIAPLVSLPLLRKD
FTVCPYQIYEAKLLGASSVLLICALLSDADIESYLQLCEDLGLDALVEAHDKQETERAIA
LGAKIIGVNNRDLKTFKVDLETSIRLRNLVPPSIIFVSESGIETKQDTRILRSHGIDAVL
VGECLMRSFDKAGMIKGFKG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatattctccagcaattggctcaatcgaccaaaaacagatacaagggaaaagaggtc
aacaggccccttgccctactcaaagaacaagcagagctctgtactcccctttcccctgcg
ttcccatttgcaagggcgttacgtaaggaaggtctctcggttatctgcgagataaaaaaa
gcttctccttccaaggggattatcagctccgacttcccgtatctggagattgccaaagag
tatgcaatagggggaggtgacgctatcagcgtattgacagaaccttccttgtttcttgga
aaagaccggtatctttcagaaattgcccctcttgtttcccttccgcttctcaggaaggac
tttacggtttgcccgtatcagatatatgaggcaaaactactgggtgcctcatcagttttg
cttatttgcgccctgctcagtgacgcggatattgaaagctacctgcagctttgcgaggat
cttggacttgacgccctggtggaagcacacgacaagcaagaaacagaacgggccattgcg
ctgggtgcaaagattatcggggtgaacaaccgtgatttaaaaacttttaaggtcgatcta
gaaaccagtatcaggctcaggaacctcgtgccgccttctatcatttttgtgagcgagagc
gggattgagacaaagcaagacacaaggattttgagatcccatggaatcgatgccgtactg
gtaggggaatgccttatgcgttcttttgataaagcgggcatgatcaaaggattcaaggga
tga

DBGET integrated database retrieval system