KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0991Help
Entry
SpiGrapes_0991    CDS       T01673                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SpiGrapes_0991
Enzymes [BR:sgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SpiGrapes_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1090433..1091029
Genome map
AA seq 198 aa AA seqDB search
MAIDTVKIEEHIRGILQALGENPDREGLKATPKRVAHMYEELFEGIQYSNDDIAKMFDKT
FEEDLYIAQGNNEIVMMRDIELFSFCEHHMALMYNMKASVAYIPNGKILGLSKIARIVDM
VSKRLQLQERIGSDIAEVIQKVTGSEDVAVIIEGQHACITTRGIKNTKSVTATTTLRGRF
HTDQNFMNKLMLLYRKEV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagatacagttaagatagaagaacatatacggggcattctacaggctttggga
gaaaaccccgacagggaaggccttaaggcaaccccaaagcgtgttgcccacatgtatgag
gaacttttcgaggggattcagtattcaaacgacgatatagcaaagatgtttgacaagacg
tttgaagaggatctctatattgctcaaggcaacaacgaaattgttatgatgagagacatc
gaactgttcagtttctgtgagcaccatatggcattgatgtacaacatgaaagcctctgtt
gcctatatccctaatggaaagatccttggactgagcaagattgcaaggattgtggacatg
gtaagcaaacggttgcaactacaagagaggatcgggtctgatattgccgaagtcatacag
aaagtcacaggttccgaggatgttgctgtcattatcgaaggacaacatgcgtgtattacc
accaggggaataaagaacacaaaatcggtaaccgcgacgacaaccctgcggggaagattc
catactgaccagaacttcatgaacaagcttatgcttctgtacagaaaagaggtctaa

DBGET integrated database retrieval system