KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0995Help
Entry
SpiGrapes_0995    CDS       T01673                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SpiGrapes_0995
Enzymes [BR:sgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SpiGrapes_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1092756..1093214
Genome map
AA seq 152 aa AA seqDB search
MTGCKMTAYLALGSNLGDREEHLRNALKMLSLTEGIEVTTVSTFINTAPVGYTDQPDFLN
AVVEIETTLDPYALLSVCNEIEQALKRKRIIHWGPRTIDVDILLFGDLILEDEKLTIPHP
RMLEREFVMKPLCEIAPKALHPVKKKTIKDLL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgactggctgtaaaatgacagcctaccttgccttggggtcaaacctcggggacagggaa
gaacatttgagaaacgccttaaaaatgctctccctgacagaggggatcgaggttacaacc
gtctcgacttttataaatacagcaccggtcggctataccgaccaacctgatttcctcaat
gcagtcgtggaaatagaaactaccttggacccgtatgccctgctttccgtgtgcaacgag
atagaacaggcgttgaaacgtaagcgcatcatccactggggaccaaggacaatcgatgtc
gatatcctgttgttcggggatctaatcctggaagatgagaagctgacaatcccccaccca
aggatgcttgaaagggaattcgtcatgaaacccttgtgcgagatcgctccaaaagccctg
cacccggtcaaaaagaaaacaatcaaagatcttctgtaa

DBGET integrated database retrieval system