KEGG   Sphaerochaeta pleomorpha: SpiGrapes_1027Help
Entry
SpiGrapes_1027    CDS       T01673                                 

Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SpiGrapes_1027
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiGrapes_1027
   00620 Pyruvate metabolism
    SpiGrapes_1027
   00650 Butanoate metabolism
    SpiGrapes_1027
  Lipid metabolism
   00071 Fatty acid degradation
    SpiGrapes_1027
  Amino acid metabolism
   00350 Tyrosine metabolism
    SpiGrapes_1027
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SpiGrapes_1027
   00626 Naphthalene degradation
    SpiGrapes_1027
Enzymes [BR:sgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SpiGrapes_1027
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SpiGrapes_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126722..1129391
Genome map
AA seq 889 aa AA seqDB search
MADKEKKSEPFEGQADLQNLIERVKRAQIKFATYSQEQVDAIFRAAAIAANDARISLAQQ
AVAETGMGIIEDKVIKNHFSAEYIFHKYKDDKTCGIIEKDSAFGIQKIAEPKGVICAIIP
TTNPTSTAIFKSLISLKTRNAIIFSPHPRAKNCTCNAARIILEAAVKAGAPEDIVGWIDA
PSMEKTDYLMKSPLVNLILATGGPAMVKSAYSSGKPAIGVGPGNTPALIEKSANIKMAVS
SILMSKTFDNGVVCASEQSIICHKDIYEEVKKELADRGAAFLDKEQADKLGSVIIDKKRG
TVNPAIVGQSASTIANLAGFAVAANAKVLIAEVSDISESEPFAHEKLSPVLAMYKCDNFG
DGTDKAAKLVALGGFGHTSVLYIDETEQDKIDTFGKTVKTSRVLVNMPASQGAIGDIYNF
MLEPSLTLGCGSWGNNSISENVGPKHLLNIKTEACRRENMLWFKLPPKIYFKFGCLPIAL
QELKGKKRAFIITDAFLFNSGMVEKITSVLEPLGIECECFHQVKPDPTLATITEGMNIMN
AFKPDVLIGLGGGSPMDAAKIMWLLYEHPEVKFEGLALRFMDIQKRIYAFPNMGKKAELV
CIPTTSGTGSEVTPFAIITDEKTGMKWAIADYALTPTMAIVDSELAMGQPKGLTASCGVD
VLTHALEALASSMSTDFTNGLSLEAARIIFKYLPTAYRDGTDKKAREKVHDASTMAGMAF
SNAFLGLCHSMAHKLGAAFHVPHGMANALLLTNIIRYNATDNPIKQAAFPQYEFPSAVSR
YARAADYIAMQVNDQSNTPYISVRQDANQDEKVEALIAGIEKLKDELNIPKSIKDWGVDE
ASFLAMVDELSVRAFDDQCTGSNPRYPLISEIKQLYLDSFYGKKWTENR
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaagaaaaaaaatcagagccattcgaaggacaagcagacttgcaaaacttg
atcgaacgcgtaaaacgcgcccagatcaaatttgctacctattcacaggaacaggttgac
gctattttcagggcagcggccatcgctgcaaatgatgctcggatctccctagcccaacaa
gccgtagcagagacaggcatgggaatcattgaagacaaagtaatcaagaaccacttttcc
gctgagtatattttccataaatacaaagacgataaaacctgtggcatcatcgagaaggac
tcagcgttcggaatccagaagattgcagagccaaaaggggtcatctgcgctatcatccct
acaaccaatcctacctccacagctatcttcaagagcctcatcagcctcaagacccgtaat
gcaatcatcttcagtccccatcccagggcgaagaactgtacgtgcaatgcggcgcgcatc
atcctggaagccgctgtgaaagccggtgctcccgaggacattgtcggctggatcgatgca
ccctcgatggaaaaaaccgactacctcatgaaaagccccttggtaaacctcatcctcgct
accggcggccctgccatggtgaaaagtgcctattcctccggcaaaccggctatcggcgta
ggacctggaaacacccctgcccttattgaaaagagtgcgaatatcaaaatggctgtcagc
tcgatccttatgtcaaagacctttgacaacggcgtcgtatgcgccagcgaacaatccata
atctgccacaaagatatctatgaggaagtaaagaaggaacttgccgaccgcggagctgct
ttccttgataaagagcaggctgataaactcggttcggttatcattgacaagaaaagggga
acggtaaacccggcaatcgttggacaaagcgcctccactatcgccaaccttgcaggtttc
gctgtagccgcgaatgctaaggtccttatcgctgaagtctctgacattagcgaatcagaa
ccctttgcccatgaaaaactcagcccggtgcttgccatgtacaagtgcgataattttggc
gatgggaccgacaaggctgctaaactggtggctttaggtggctttgggcacaccagcgtc
ctgtatatcgatgaaacggaacaggataaaattgatacctttggcaaaacggtaaaaacc
agcagggtcttggttaacatgccggcaagccagggagctatcggggacatctacaatttc
atgctcgagccttcccttaccctcggttgtggatcctggggaaacaactccatcagcgaa
aacgtcggtccaaaacaccttttgaacatcaagaccgaagcctgcaggagggaaaacatg
ctctggttcaaactgcctcccaaaatctatttcaaatttggttgtctgcccattgcattg
caggaactgaaaggcaagaaacgtgcctttatcatcaccgatgccttcctgttcaacagc
ggcatggtagaaaaaattacctctgtccttgaaccgctcggaatcgaatgcgaatgcttc
caccaagtcaaacccgacccgacccttgccactattaccgagggaatgaatatcatgaat
gccttcaagcctgatgtgctcattggccttggcggcggatccccgatggatgccgcaaag
atcatgtggttgctgtatgaacatcccgaggtaaaattcgaaggccttgccctgcgcttc
atggacatccaaaagagaatctacgccttccccaacatgggcaagaaagcggaattggta
tgcatccccactaccagcggaactggtagcgaagtcaccccgtttgccatcatcaccgat
gaaaaaaccggcatgaaatgggcaatcgccgactatgcactcacccccacgatggcaatc
gtggacagcgagctggctatgggacaacctaagggcctgactgcaagttgcggtgttgat
gtcttgacccatgccctggaagccttggcttcaagcatgtccaccgattttaccaacgga
ctctcactcgaggctgccaggattatcttcaagtatcttccgaccgcctaccgtgacggc
actgacaaaaaagcaagggaaaaagtgcacgatgcctccaccatggccggcatggccttc
tccaacgctttcctcgggctctgtcattcgatggcacacaagctgggggcggccttccat
gtaccccatgggatggcaaacgcactgctcttgaccaacattatccgctataacgctacg
gacaacccgatcaagcaggcagcattcccccagtatgagttcccttcggcagtaagccgg
tatgccagggcagcagactacattgccatgcaggtcaatgaccagagcaacaccccttac
atttcggtaaggcaggatgcgaatcaggatgagaaagttgaggcattgattgcgggcatc
gaaaagctgaaagacgagctcaacattcccaagtctatcaaagactggggtgtggacgag
gcatcctttttggctatggtcgatgaactgtcggtacgggcattcgacgaccaatgtact
ggaagcaatccccgttacccactgatcagcgagatcaagcaactataccttgatagcttc
tatgggaaaaagtggaccgaaaacagatag

DBGET integrated database retrieval system