KEGG   Sphaerochaeta pleomorpha: SpiGrapes_1094Help
Entry
SpiGrapes_1094    CDS       T01673                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SpiGrapes_1094
   00051 Fructose and mannose metabolism
    SpiGrapes_1094
Enzymes [BR:sgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SpiGrapes_1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1204340..1205668)
Genome map
AA seq 442 aa AA seqDB search
MEYFVGDKEYFKGIGKIQFEGKGSDNPLAFRYYDADKKIGTKTMAEHLRFATAYWHSFCA
NGADPFGSATITFPFADKDPMTEAFAKADAAFEFFTKLGTQYYCFHDADVAPMSDDAKTY
EKNYHKVADVLLARQKATGVKLLWNTANAFSHPFYMNGAATNPDFAVVSRAALQVKNCLD
VNVQLGGSNYVFWGGREGYMSLLNTDMKREREHLGRFLAMARDYGRSIGFKGTFLIEPKP
MEPSKHQYDYDAQTAIAFIREFGLEADFKCNIEANHATLAGHTFAHDLQVCADNHMLGSV
DANQGDAQNGWDTDEFPSNVYETVSAMLVILRQGGLKDGGLNFDAKRRRNSTDLEDLFIA
HIGGMDSFALGLEIANRIIEDGKFDSLVKNRYASFDAGNGNLFEAGKMDFATLAEMGRNA
QIVQHSGKQEYLNNLLNSYLFG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggaatattttgtaggtgacaaggaatacttcaagggaatcgggaagattcagtttgag
ggaaaaggcagtgataatccactcgccttcaggtattatgacgccgataagaaaatcggt
accaagaccatggcagaacatctgagatttgccaccgcctattggcatagtttctgtgcg
aatggagccgatcccttcggaagcgcaacgattacgtttcctttcgcagacaaagaccct
atgaccgaggcttttgccaaggctgatgcagcctttgaattctttacgaagctcggtacc
cagtactactgcttccatgatgcagatgtcgctccgatgagtgacgatgcaaagacctat
gagaagaactaccataaggttgccgacgtcctgcttgccaggcagaaggccaccggggtc
aagttgctctggaatactgccaatgctttcagccatcctttctatatgaatggggcagca
accaatcctgacttcgccgttgtttcccgtgcagccctgcaggtaaaaaattgcctggat
gtaaatgtgcagcttggcggtagcaattatgttttctggggtggccgtgaagggtatatg
tcattgctcaacactgatatgaagcgggaacgtgaacatcttggccgtttccttgccatg
gcacgcgattatggccggagtattggtttcaaaggcaccttccttatcgaacctaaaccg
atggaaccttccaagcaccaatatgactacgatgcccagactgcaattgcctttatcagg
gaatttgggcttgaggccgatttcaagtgcaatatcgaggctaaccatgcgacactggcc
ggccatacgtttgcccatgacctgcaggtctgtgccgacaaccacatgctgggaagtgtc
gatgccaaccagggtgatgcccagaatggttgggataccgatgaattcccctcaaatgtc
tacgagactgtttccgcgatgttggtcatcctccgtcagggtggactcaaagatggcggt
ttgaacttcgacgcaaagcgcaggaggaattccactgacctggaagacttgttcattgcc
catatcggaggcatggatagtttcgcccttggtctggaaattgccaacaggattatcgag
gacgggaagttcgattccttggtaaagaatcgttatgcatcttttgatgcgggaaacggc
aatctgttcgaggcagggaagatggattttgcaacccttgccgagatgggcagaaatgca
caaatcgtacagcacagtggcaaacaggaatatctgaacaacctgctcaattcctacctg
ttcggttag

DBGET integrated database retrieval system